KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0892Help
Entry
CJS3_0892         CDS       T01856                                 

Definition
(GenBank) cytoplasmic domain of flagellar protein FhlB-like protein
  KO
K04061  flagellar biosynthesis protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cjs02044]
    CJS3_0892
Secretion system [BR:cjs02044]
 Type III secretion system
  Flagellar export apparatus
   CJS3_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_export_2 B2 Svf1_C DUF2795
Motif
Other DBs
NCBI-ProteinID: ADT72627
Position
complement(827531..827812)
Genome map
AA seq 93 aa AA seqDB search
MSKIKRSIKKAVALGYQKEKNSAPKVLASGKGESAAKIISLAKEHGVPIKEDEDLIEILS
KLDLGDEIPPNMYKAVAEVFAFIYQMANKTPKN
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcaaaagatcgattaaaaaagctgtagctctaggctatcaaaaagaaaaa
aactctgcaccaaaagtacttgcaagtggcaaaggcgaaagtgctgctaaaattatttct
ttagccaaggaacacggagttcctattaaagaagatgaagatttaatagaaattttaagc
aagcttgacttaggtgatgaaattccacctaatatgtataaagctgtagctgaagttttt
gcctttatctatcaaatggcaaataaaactcctaaaaactaa

DBGET integrated database retrieval system