KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0894Help
Entry
CJS3_0894         CDS       T01856                                 

Definition
(GenBank) Transmembrane transport protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr BT1 DUF5397
Motif
Other DBs
NCBI-ProteinID: ADT72629
Position
complement(829913..831073)
Genome map
AA seq 386 aa AA seqDB search
MTALFAGMAFLFAGNALIVSSIGVILKENGESSLAVGVVSSCFFVGALIGTISAHKIISR
IGHIRSFGLFGAIFGISAMLHTVSENLIFWAVLRFFIGICYYGLLMVIESWLNEKSKNAI
RSRILGFYEIVFYLAFGIGVLIIALNLSKHSVFILSATLILLSSLPLNLIKIKEPVLPAS
SPISMPKIFDIAPLAIVTSFIAGMLINGFFSMASLFILLQGFDTKAVSYFIFCGVLGGFI
AQTIIGTISDKLGRKFAIITCASIGFITMLIFIFFKLHLYMQYFLGITLGIGIFCLYALA
LARANDVLVSKNKGVELGRGVLFCYSLGSLFGPLILGFLMQYFEIKGFIWFYIVSLVFLI
LFAINKPNILNKKFKKKPGNMVIFDD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacagcactttttgctggtatggcatttttatttgcaggtaatgccttgatagtaagc
tctataggtgttatattaaaagaaaacggagaaagttctttagctgttggagtagtaagt
tcttgtttttttgtaggcgctcttattggaaccatcagtgctcataaaattatttctcgt
ataggtcatatacgctcttttgggctatttggtgctatttttggaatttcagctatgctt
catacagtaagcgaaaatcttattttttgggctgttttaagatttttcataggaatttgc
tactatggacttttaatggtcatagaatcatggcttaatgaaaaaagcaaaaatgccatt
cgatctagaattttaggtttttatgaaattgttttttatcttgcgtttggtattggagtt
ttaatcatagcgttaaatttaagcaaacatagtgtatttatcctcagtgcaactttaatt
ttactttcatctttacctttaaatctaattaaaatcaaagaacctgttttacctgcatca
agtcctatttctatgcctaaaatttttgatatagctcctttagctatcgtcacaagcttt
atagccggaatgcttataaatggctttttttctatggcatctttatttatacttttgcaa
ggttttgatacaaaagcggtttcttattttatattttgtggggttttaggtggttttatt
gcacaaaccatcataggaactatttcagacaaacttggtcgcaaatttgccattatcact
tgtgcaagtataggatttatcactatgcttatatttatcttttttaaacttcatttatat
atgcaatattttttaggaattactcttggtataggaatattttgcttatatgctttagca
cttgctagagcaaatgatgttttagtaagcaaaaataaaggtgtagagttaggtcgtggg
gttcttttttgttattctttgggctctttgtttggccctttaattttaggttttttaatg
caatattttgaaatcaaaggttttatatggttttatatagtttctttagtatttttaatt
ctttttgctatcaataaaccaaatattttaaataaaaaatttaagaaaaagcctggaaat
atggtgatatttgatgattaa

DBGET integrated database retrieval system