KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0897Help
Entry
CJS3_0897         CDS       T01856                                 

Gene name
hemL
Definition
(GenBank) Glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00860  Porphyrin and chlorophyll metabolism
cjs01100  Metabolic pathways
cjs01110  Biosynthesis of secondary metabolites
cjs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CJS3_0897 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cjs01007]
    CJS3_0897 (hemL)
Enzymes [BR:cjs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     CJS3_0897 (hemL)
Amino acid related enzymes [BR:cjs01007]
 Aminotransferase (transaminase)
  Class III
   CJS3_0897 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADT72632
Position
complement(831907..833181)
Genome map
AA seq 424 aa AA seqDB search
MTNKKAFKEACKFIAGGVNSPVRAFANVQSEPKFISHGKGAYIFDIDGNSYIDYVQSWGP
LLFGHCDKDIQKACQKALHKGSSFGAPTLLETELAKLVLSDFPHLEKIRFVSSGTEATMS
AIRLARGFTKKDKILKFEGCYHGHSDSLLVSAGSGAATFNSPSSLGVLEDVAKHTLVAKY
NDINSVKELFEKNKDIACVIIEPIAGNMGLVPAKQDFLEELAKICKNNQTLLIFDEVMSG
YRASYLGSYGINHIQADIITFGKVIGGGLPAAAFASRAEIMDILSPLGGVYQAGTLSGNP
LAMAAGIASLTKAKKKTKLYDKLGKLAKKLTQGMKKLADEKGLPLQVCHVGSMFGYFFTK
DPVSNYQDALKSDLALFSKFHKNMLENGIYLAPSQFETGFICSKMDDKIIDTTLEAVRES
FKRI
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacaaaaaagcttttaaagaagcgtgtaaattcatcgcaggtggtgtaaattct
ccagttcgtgcttttgcaaatgttcaaagtgagccaaaatttatttctcatggaaaaggt
gcttatattttcgatatagatggaaattcttatatagactatgttcaaagctgggggcct
ttactttttggacattgcgataaagatatacaaaaagcttgtcaaaaagcacttcataaa
ggttcaagttttggagctccaactttattagaaactgaacttgccaagcttgttttatct
gattttcctcatttagaaaagatccgctttgtaagcagtggaacagaagcaaccatgagt
gctattcgtcttgcccgtggttttactaaaaaagataaaattttaaaatttgaaggatgt
tatcacgggcattctgattcattattagtgagtgcaggaagtggtgctgctacttttaac
tctcctagttctttgggtgttttagaagatgtagctaaacacactttagtagctaaatat
aatgatataaatagcgttaaagagctttttgaaaaaaataaagatattgcatgtgttatc
attgagcctattgctggaaatatggggttagttccagctaaacaagattttttagaagaa
cttgctaagatctgtaaaaacaatcaaactctgctgatttttgatgaagtaatgagtgga
tatagagcatcttaccttggttcctatggaatcaatcatatccaagcagatataattact
tttggtaaggtaataggaggcggtctacctgcagcagcatttgcttctagagctgaaatt
atggatattttaagtcctttgggtggagtttatcaagcaggaactttaagtggaaatcct
ttagcaatggctgcaggtatagcaagtcttacaaaagccaaaaagaaaaccaagctttat
gacaaacttggaaaattagcaaaaaaacttacccaaggaatgaaaaaattagcagatgaa
aaaggacttccactgcaagtttgtcatgtaggttctatgtttggatactttttcaccaaa
gatcctgtatcaaactaccaagatgcattaaaatccgatctagcattattttcaaaattt
cacaaaaatatgcttgaaaatggaatttatttagcaccttctcaatttgaaacaggcttt
atatgttcaaaaatggatgataaaattatagatacaacactagaggctgttagggaaagc
tttaaaagaatatga

DBGET integrated database retrieval system