KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0900Help
Entry
CJS3_0900         CDS       T01856                                 

Gene name
lepB
Definition
(GenBank) Signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs02024  Quorum sensing
cjs03060  Protein export
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CJS3_0900 (lepB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CJS3_0900 (lepB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjs01002]
    CJS3_0900 (lepB)
Enzymes [BR:cjs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     CJS3_0900 (lepB)
Peptidases [BR:cjs01002]
 Serine Peptidases
  Family S26: signal peptidase I family
   CJS3_0900 (lepB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S24 Peptidase_S26 DcuC
Motif
Other DBs
NCBI-ProteinID: ADT72635
Position
834463..835311
Genome map
AA seq 282 aa AA seqDB search
MEILKKLYKFSQSWTGTVVIVLLVIFFFIQAFVIPSGSMKNTLLVGDFLFVKKFSYGIPT
PHIPWLEIPVLPDFNKDGHLIKAQGSQRGDIVVFRNPRNEKEHFVKRCVGTGGDRIVYAN
KTLYVRMHEGDEFMKEHYPNDLVTLGGRIYVKEPYKQKGIHYDPKKDIESDILRFLSIGD
FAMSPTYIKELGNHIGFSGGNAYVFDVPENEYFMMGDNRDYSYDSRFWGSVPYRLIVGKP
WFVYFSWDKDKNVRWERIGRFVDTLENDEQYIHDHDDEDKLS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggaaattttaaagaaattatataaattttcacagtcttggactggaactgtagttatt
gttcttttggtgatttttttctttatacaagcttttgttattccttctggttctatgaaa
aacaccttattggtaggggattttttatttgttaaaaaatttagctatggtatcccaact
cctcatattccttggttggaaattcctgttttgccagatttcaataaagatgggcatttg
ataaaagcacaagggtcacaaagaggagatatagttgtttttagaaatcctagaaatgaa
aaagaacactttgtaaagcgttgtgtaggcacaggaggagataggatagtttatgcaaat
aaaacactttatgtaagaatgcatgagggtgatgaatttatgaaagaacattatccgaat
gatcttgttactcttggagggcgaatttatgtaaaagaaccttataaacaaaaaggtatt
cattatgatccaaaaaaagatatagaaagcgatattttacgctttcttagcataggtgat
tttgctatgtctccaacttatattaaagaacttggaaatcatataggttttagcggcgga
aatgcttatgtttttgatgtgcctgaaaatgagtatttcatgatgggtgataatcgcgat
tattcttatgatagtcgtttttggggttctgttccttataggttgatagtaggtaaacct
tggtttgtatatttctcttgggataaagataaaaatgttcgctgggaaaggatagggcgt
tttgttgataccttggaaaatgatgaacaatatatccatgatcatgatgatgaggataaa
ttaagctaa

DBGET integrated database retrieval system