KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0901Help
Entry
CJS3_0901         CDS       T01856                                 

Definition
(GenBank) Molybdopterin biosynthesis MoeA protein
  KO
K03750  molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00790  Folate biosynthesis
cjs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CJS3_0901
Enzymes [BR:cjs01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     CJS3_0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoeA_N MoCF_biosynth MoeA_C OCIA RNA_pol_Rpb1_5
Motif
Other DBs
NCBI-ProteinID: ADT72636
Position
complement(835333..836493)
Genome map
AA seq 386 aa AA seqDB search
MKNIFKTLKDLENQISCLDESELISLEKAKDRILAKDLYARKNLPSFDNAALDGYAFNYT
DINEALEIKGTIFAGDKNFYTVAKNECYKIMTGAKMPKNADTILMLEDEYIEENKLIIKK
APKQYNAYRYKGEELKKGEILLQKGTKLNDKHIALLASQGLYKIEVIRKIRIGIFSSGNE
LKEPWQECDEESIYNANALPLLTMLQNASYLGIIKDNFKSTKEALENTNFDLLITSGGAS
VGEADFMEKALDELGFTPLFKGLKARPARPTKLYRKGENFVLILPGNPMAAYLSCFIFAK
KIIALLSGNLDNPLTFYGKMGMDLKLKSGRNNLILGNLEKDIFTPFNENKFGSGMILPLI
KSEFLLISEENISKLKKGDEITLLKI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatctttaaaaccttaaaagacttagaaaatcaaatttcatgcttagatgaa
agtgagcttattagccttgaaaaagcaaaggatagaattttagctaaagatttatacgct
agaaaaaatttacctagttttgacaatgctgctcttgatggctatgcttttaattatact
gatatcaatgaggctttggagattaaagggactatttttgcaggagataaaaatttttat
acagttgctaagaatgaatgctataaaatcatgacaggggctaaaatgcccaaaaatgct
gatactatcttaatgttagaagatgagtatatagaagaaaataaactcatcattaaaaaa
gcccctaaacaatacaatgcctatcgctataaaggcgaagaattaaaaaaaggtgaaatt
ttacttcaaaaaggcaccaaacttaatgataaacatatcgccctgcttgcttctcaaggg
ctttataaaatagaagtcataagaaaaattcgcataggtattttttcaagtggaaatgag
ctaaaagaaccttggcaagaatgcgatgaagaaagtatttataatgctaatgctttgcct
ttactaaccatgcttcaaaatgcttcttatttaggtattatcaaagataattttaaaagc
actaaagaggctttagaaaatacaaattttgatcttttaatcacttcaggaggtgcaagc
gttggcgaggctgattttatggaaaaagctttagatgaattaggctttactccgcttttt
aaaggactaaaagcacgccctgcaagacctactaagctttatagaaagggtgagaatttc
gtattgattttaccaggaaatcccatggcggcctatctttcttgttttatttttgctaaa
aaaattattgctttattaagtggaaacctagacaatcctttaacattttatggcaaaatg
ggtatggatttaaagcttaaaagcggaagaaataatctcatcttaggaaatttagaaaaa
gatatttttacaccatttaatgaaaataaatttggatctggtatgatacttccacttatt
aaaagtgaatttttacttataagtgaagaaaatataagcaaattaaaaaaaggtgatgaa
atcacgcttttaaaaatataa

DBGET integrated database retrieval system