KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0909Help
Entry
CJS3_0909         CDS       T01856                                 

Definition
(GenBank) Inner membrane thiol:disulfide oxidoreductase, DsbB-like protein
  KO
K03611  disulfide bond formation protein DsbB
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cjs03110]
    CJS3_0909
Chaperones and folding catalysts [BR:cjs03110]
 Protein folding catalysts
  Protein disulfide isomerase
   CJS3_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbB TctB
Motif
Other DBs
NCBI-ProteinID: ADT72644
Position
843896..844681
Genome map
AA seq 261 aa AA seqDB search
MKDNCRNFSLSKWQDTRKPWLILIIVTIGLTCIAHFLFQEYLFMKPCEQCVYIRFDMLVM
AIGGMIALINPANNIIKIFSYSLAFYGIWLGLEHCLTLNHIHEVVHSENPFAGVDGCREI
PIYPFNLPLYKWAPSWFLPTGECGMDTPVVPENAYNHLNAFQKFFIGTPPDFENGLYSNG
WYLIPSLKFMNMAICCLIAFLCCFVVLFAMFIAYVLDKNKPNAKIFALVIVALVLVLKFI
GESKNPNQNIASLNQVVLRYS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataattgcagaaatttttcactttccaaatggcaagatacgcgcaaaccttgg
ttgattttgattatagttactatagggcttacttgtatagcacattttttatttcaagaa
tatctttttatgaaaccttgtgaacaatgtgtgtatataagatttgatatgcttgttatg
gctataggtggtatgattgcattaatcaaccctgcaaataatattataaaaattttttct
tatagcttagctttttatggaatttggcttggcttggagcattgtctaactttaaatcat
atccatgaagtggttcattctgaaaatccttttgcaggcgtagatggatgtcgtgaaatt
cctatttatccatttaatttacctttgtataaatgggctcctagttggtttttgccaaca
ggagaatgcgggatggatacccctgtagttccagaaaatgcttataatcatcttaatgct
tttcaaaaattttttataggaactccacctgattttgaaaatgggctttatagtaatggt
tggtatttgattcctagtttaaagtttatgaatatggcaatctgctgtcttatagcattt
ttatgttgttttgtcgtgctttttgcaatgtttatagcctatgttttagataaaaataaa
cctaatgctaaaatttttgcattggtgattgttgctttggttttggtgcttaaatttata
ggcgaatcaaaaaatccgaatcaaaatatagctagtttaaatcaagtcgttttaagatac
tcttaa

DBGET integrated database retrieval system