KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0930Help
Entry
CJS3_0930         CDS       T01856                                 

Definition
(GenBank) Two-component system histidine kinase
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ADT72658
Position
complement(860839..862128)
Genome map
AA seq 429 aa AA seqDB search
MLKTKNIFIVFFVVLALIFGFIFYTFTNSYLNFLLIKQYEQKIKSLDDVLKFSLLEHLND
ANIKDFAKDTRADFIILNNDMKISSVKNPDFFSNLKEGEILNFNSKKILTKSFICKGYKY
IIIVYPRFLDLELFWTKMAIGFGVCLLFVFILMLLLGRRIEKNFNKILDFLDSIGDHKVV
ILEKGMFKEFNLLNEKLLKTKDKILKNTQKNKKQSDKITLKNTQLASVISAISHELKNPL
SVIDLSLEMLKDEKLEDKKLKKELLEKISRQSVKLNALTHKLNFVFNLNSEALQMQEFDL
FSLCEKITKNPGFERVALQGKSTKVKADEFLIEQVIINLLSNALKYSQKKVILTARDQKI
IVQDFGKGIEEDKIKLITKKFYKIDVKSNNSFGLGLFLVKKILNIHKSYLEISSTLGYGS
SFSFKLSQG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaactaaaaatatttttatagttttttttgttgtattggctttgatttttggg
tttattttttatacttttactaattcttatcttaatttcttgcttataaaacaatatgaa
caaaaaatcaaaagccttgatgatgttttaaaattttctctcttagagcatttaaatgat
gctaatatcaaggattttgctaaagatactagggctgattttattatcctaaacaatgat
atgaaaataagttctgtaaaaaatcctgattttttttctaatcttaaagaaggagaaatt
ttaaatttcaattcaaaaaaaattctcactaaaagctttatttgcaaaggatataaatat
attattattgtttatcctcgttttttagatttagaacttttttggacaaaaatggcaatc
ggttttggagtatgcttgctgtttgtttttattttaatgttgttgttaggtagaagaata
gagaaaaattttaataaaattttggattttttggattctataggggatcataaagttgtt
atattagaaaaaggaatgtttaaagaatttaatttactaaatgagaaacttttaaaaact
aaggataaaattctaaagaatacccaaaaaaataaaaaacaaagcgataaaatcacttta
aaaaatactcagcttgctagcgtgatttctgctatttctcatgaacttaaaaatccatta
agcgtgattgatcttagcttagagatgctaaaagatgagaaattggaagataaaaaatta
aaaaaggaattactagaaaaaatttcacgtcaaagcgttaaacttaatgctttaacccat
aagcttaattttgtttttaatcttaatagtgaagccttgcagatgcaagaattcgatctt
ttttctctatgtgaaaaaatcactaaaaacccaggctttgaaagagttgcattgcaaggt
aaaagcacgaaagttaaggctgatgaatttttaatcgagcaagtgattataaatttgctt
tctaatgctttaaaatatagtcaaaaaaaagtcattttaacggcaagagatcaaaagata
atagtgcaagattttggaaaaggtatagaagaagataaaataaaattgattacaaaaaaa
ttttataaaattgatgtaaaaagtaataattcttttggtttgggactttttttagtaaag
aaaattttaaatatacataaaagttatcttgaaatttctagcactttaggttatggttct
agttttagctttaaactcagtcaaggataa

DBGET integrated database retrieval system