KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0932Help
Entry
CJS3_0932         CDS       T01856                                 

Gene name
serA
Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00260  Glycine, serine and threonine metabolism
cjs00680  Methane metabolism
cjs01100  Metabolic pathways
cjs01120  Microbial metabolism in diverse environments
cjs01130  Biosynthesis of antibiotics
cjs01200  Carbon metabolism
cjs01230  Biosynthesis of amino acids
Module
cjs_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CJS3_0932 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJS3_0932 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjs04147]
    CJS3_0932 (serA)
Enzymes [BR:cjs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     CJS3_0932 (serA)
    1.1.1.399  2-oxoglutarate reductase
     CJS3_0932 (serA)
Exosome [BR:cjs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CJS3_0932 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 ACT_7 IlvN UDPG_MGDP_dh_C NAD_binding_7 ACT_6 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADT72660
Position
complement(862771..864354)
Genome map
AA seq 527 aa AA seqDB search
MKKKIIVCDAILDKGVDILRKAEDIELIEAAKFPKDELMQMLSDIEVAITRSSTDVDVNF
LNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFVN
AHNFLKIERKWEREKWYGIELMNKTLGVIGFGNIGSRVAIRAKAFGMKILAYDPYISASK
ITDLDMEQAKNLDEILEKSDFITIHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYT
EEALYEGLKSGKIAWLGIDVFDKEPATNHPLLDFENISVTSHLGANTLESQDNIAREACE
QALSAARGVAYPNALNLPIKTEDLPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGI
IGEYANSMLTFAAVGALGGILGEKINYVNAEFVAKEKGVELSCETLPNSGYNNKLSVKII
TENSNISVSGTVFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNI
NIADFRLGRDGFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaagattatagtgtgtgatgctattttggataaaggtgtcgatattctaaga
aaagctgaagatattgagcttatagaagctgcaaaatttccaaaagatgaacttatgcaa
atgctaagcgatattgaagttgcaattactagaagttctacggatgtagatgtaaatttt
ttaaatcatgccaaaaaattaaaagcgcttgtgcgtgctggggtgggcgtagataatgtt
gatattccagagtgttctaaacgaggagtgattgtgatgaatgtcccaactgcaaatact
attgccgcagttgaactaacaatggcacatcttttaacatcagctagaagctttgtcaat
gctcataattttttaaaaattgaaagaaaatgggaaagagaaaaatggtatggcattgaa
ttgatgaataaaacgctaggggttataggttttggaaatataggttcaagagtagctatc
cgtgctaaagcatttggtatgaaaattttagcctatgatccgtatatttctgcttctaag
attacagatttagatatggaacaagcaaaaaatttggatgaaattttagaaaaaagtgat
tttattaccattcacacaccaaaaaccaaagaaaccaatggtatgataggaaagcaagaa
attgcaaaaatgaaagatggaataagattaataaattgtgctcgcggaggattatacaca
gaagaggctttatatgaaggtttaaaaagtggtaaaatagcatggcttggtatagatgtg
ttcgataaagaacccgcaaccaatcatcctcttttagactttgaaaatatttcagttact
tctcacctaggagcaaatactttagaaagtcaagacaatatcgcaagagaagcttgtgag
caagcattaagtgcagcacgaggcgtggcttatcctaatgccttaaatttaccaattaaa
actgaagacttaccaccttttgtagctccttatatagaacttgtttctaaaatggctttt
ttagctgttcaaattgataaaaatcctataaaaagtattaaattagaggctgaaggaatt
attggtgagtatgcaaattctatgctaacttttgcagctgttggtgctttgggtggaatt
ttaggagagaaaattaattatgttaatgcagaatttgttgccaaagaaaaaggagttgaa
ttatcttgcgaaactcttccaaatagtggttataataataaacttagcgttaaaattatc
accgaaaattcaaatatcagtgtttcaggaacagtgtttaatgaaaatgaacaacgcata
gttggattaaatggctttaaaactgattttaagccaaagggaaaaatgattatttttaaa
aacaaagacataccaggagttatagctaaaatcagttccgttttggcagctaaaaatatc
aacatagctgattttaggcttggtagagatggttttgggtatgctttggctgttgttttg
attgatgaaaaagttcaaaaagaagtattagatgaactaaaacaattagaggcgtgtgta
tttgtccaatatgttgaaatttaa

DBGET integrated database retrieval system