KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0935Help
Entry
CJS3_0935         CDS       T01856                                 

Gene name
ispH
Definition
(GenBank) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase
  KO
K03527  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00900  Terpenoid backbone biosynthesis
cjs01100  Metabolic pathways
cjs01110  Biosynthesis of secondary metabolites
cjs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CJS3_0935 (ispH)
Enzymes [BR:cjs01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     CJS3_0935 (ispH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LYTB XPA_C
Motif
Other DBs
NCBI-ProteinID: ADT72663
Position
complement(866641..867474)
Genome map
AA seq 277 aa AA seqDB search
MIIELAKNYGFCFGVKRAIKKAEQIKDAATIGPLIHNNEEISRLQKNFNVKTLENIQALS
NEKKAIIRTHGITKQDLEELRKKDIEIFDATCPFVTKPQQICEQMSKEGYEVVIFGDENH
PEVKGVKSYVSTKAYVVLDKKELQNIKLPNKIAVVSQTTKKPEHFMEIVNFLILKTKEVR
VFNTICDATFKNQDAIKELSLKSDVMVVVGGKNSANTKQLFLIAKTNCEDSYLIETEEEL
KKEWFLDKKHCGISAGASTPDWIIQKVIAKIENFKIN
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgattattgaattagcaaaaaactatggtttttgttttggtgttaaaagagctattaaa
aaagcagaacaaataaaagatgctgcaactataggccctcttattcacaataacgaagaa
atttctcgtttgcaaaaaaattttaatgtcaaaactttggaaaatatacaagctttaagt
aatgaaaaaaaggctattataagaactcatggtattacaaagcaagatttagaagaattg
agaaaaaaagatatagaaatttttgatgccacttgtccttttgttacaaaaccacaacaa
atttgcgagcaaatgagtaaggagggttatgaagttgttatttttggagatgaaaatcat
cccgaagttaaaggagtcaaaagttatgtaagtacaaaagcttatgtagttttggataaa
aaagaacttcaaaatataaaacttcctaataaaatagctgtagtaagccaaacaactaag
aagcctgagcattttatggagatagtaaattttttaatacttaaaaccaaagaagtaaga
gtttttaacactatatgtgatgcaacctttaaaaatcaagatgccattaaagaactctcg
cttaaaagtgatgttatggttgttgtagggggtaaaaactcagccaatacaaaacaactt
tttttgattgcaaaaaccaattgtgaagatagctatctaattgaaaccgaagaagagtta
aaaaaagaatggtttttagataaaaaacattgtggcattagtgcaggtgctagtactcct
gattggattatacaaaaagttatcgccaaaatagaaaattttaaaattaattaa

DBGET integrated database retrieval system