KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0943Help
Entry
CJS3_0943         CDS       T01856                                 

Definition
(GenBank) Putative glutamine transport ATP-binding protein
  KO
K02028  polar amino acid transport system ATP-binding protein [EC:7.4.2.1]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Module
cjs_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjs02000]
    CJS3_0943
Enzymes [BR:cjs01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     CJS3_0943
Transporters [BR:cjs02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    CJS3_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_23 AAA_29 RsgA_GTPase AAA_22 PRK SbcCD_C AAA_18 AAA_16 AAA_25 AAA_30
Motif
Other DBs
NCBI-ProteinID: ADT72671
Position
874135..874863
Genome map
AA seq 242 aa AA seqDB search
MIEVKNLQKKYGELEVLKNINTTISKGDVIAIIGPSGGGKSTFLRCINRLELADSGEILI
NKQNILDKEIDINKIRQKVSMVFQHFNLFANKNVMENLCLTPIKTGILSQEEAIKKAKLL
LAKVGLADKENIMPHKLSGGQKQRIAIARSLMMNPDVILFDEPTSALDPEMIGEVLSIMK
DVAKEGLTMLVVTHEMGFARNVANRIFFMDKGKIAVDASPKEVFENPSNERLREFLNKVL
NH
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagttaaaaatttacaaaaaaaatatggagaattagaagttttaaaaaatatt
aacactacaatctcaaaaggcgatgtaatagctatcataggtccaagtggaggcggaaaa
agtacatttttacgctgcatcaatcgcttagaactagctgatagtggggaaattttaatc
aataagcaaaacatacttgataaagaaattgatattaataagatcaggcaaaaagttagc
atggtatttcagcattttaatctttttgctaataaaaatgttatggaaaatttatgttta
acgcccattaaaacaggaattttaagtcaagaagaagccataaaaaaagcaaaattactt
cttgctaaggtgggtttagcagacaaagaaaatataatgccccataagctctctggcgga
caaaaacaacgcatagctattgctagaagcttgatgatgaatcctgatgttattttattt
gatgaacctacttcagctctagatcctgaaatgataggcgaggttctaagcattatgaaa
gatgttgcaaaagaaggtttaactatgcttgtagtaactcatgaaatgggctttgctaga
aatgttgccaatcgtatattttttatggataaaggaaaaattgctgttgatgcaagccct
aaagaagtatttgaaaatcctagcaatgaaagattgagagaatttttaaacaaggttttg
aatcattaa

DBGET integrated database retrieval system