KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0947Help
Entry
CJS3_0947         CDS       T01856                                 

Definition
(GenBank) Putative periplasmic protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD
Motif
Other DBs
NCBI-ProteinID: ADT72675
Position
complement(877918..878895)
Genome map
AA seq 325 aa AA seqDB search
MLKRLALLITLSSLMLHASDLVKIYLNQGLDAVGVAIEKELTQKDFWLSEIGDKNISLGY
YDDNVAIVLTNKTDKILRVYSYEDGKIRKDFEQKEIITGLMGDKKIEGDLKTPVGFYELG
RKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRLDEFKTRGCIALFNN
NLEKFAQVVQDKKVFVMTEEKEKIRAKKDQIASLLADLFTWKLAWTNSDTNTYLSFYDEQ
EFKRFDKMKFEQFASMKKSIFSRKEDKKIKFSDINISPYPNLENETMYRISFYEDYYTKN
YQFRGDKILYVKIDSKGKMKILAEQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaaacgacttgctttattaattacactttcttcattgatgttacatgcctcagat
cttgttaaaatttatcttaatcaagggttagatgctgttggtgtagcgattgaaaaagaa
ttaactcaaaaggatttttggttaagtgaaataggagataaaaatatttcacttggatac
tatgatgataatgttgctatcgtacttacaaataaaacagataaaattctccgtgtttat
tcttacgaggacggaaaaataagaaaagattttgaacaaaaagaaataataactggatta
atgggcgataaaaaaatagaaggagatttgaaaacgccagtaggtttttatgagttaggc
cgtaagtttaatccaggtgatccttattatggtccctttgcttttgctacaacttatcca
aatttacttgataaagtacaaggaaaaacaggtggtggtatttggatccatggctatcct
ttagatggttctagacttgatgaatttaaaacaagaggatgtattgctttatttaataat
aatttggagaaatttgcacaagttgtacaagataaaaaagtttttgttatgacagaagaa
aaagaaaaaattagagctaaaaaggatcaaatagctagtttattggctgatctttttaca
tggaaactagcttggacaaatagtgatactaatacctatttaagtttttatgatgagcaa
gaatttaaacgttttgataaaatgaaatttgaacagtttgcttccatgaaaaaatctatt
ttttctcgtaaagaagataaaaagattaaattttcagatattaatatcagcccttatccg
aatttagaaaatgaaactatgtatagaatttcattttatgaggattattacactaaaaac
tatcagtttagaggcgataaaattttatacgttaagatagatagtaaaggtaaaatgaaa
attttagcagagcaataa

DBGET integrated database retrieval system