KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0953Help
Entry
CJS3_0953         CDS       T01856                                 

Definition
(GenBank) Cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00270  Cysteine and methionine metabolism
cjs00920  Sulfur metabolism
cjs01100  Metabolic pathways
cjs01110  Biosynthesis of secondary metabolites
cjs01120  Microbial metabolism in diverse environments
cjs01130  Biosynthesis of antibiotics
cjs01200  Carbon metabolism
cjs01230  Biosynthesis of amino acids
Module
cjs_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CJS3_0953
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CJS3_0953
Enzymes [BR:cjs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     CJS3_0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP GrpB TniB
Motif
Other DBs
NCBI-ProteinID: ADT72681
Position
complement(881047..881946)
Genome map
AA seq 299 aa AA seqDB search
MKVYEKVSELIGNTPIIHLKKFGINVFAKCEFLNPSHSIKDRAAFEMIKDALDSKKINQD
TTIVEATSGNTGISLAMICADLGLKFIAVMPESMSLERRKMITLFGARLELTPANLGMKG
AVDKANEILLNTPNSFMVSQFENISNKNAHRKNTALEILRDLDNELDIFVAGFGTGGTIS
GVGEILKEKLEKVHIVGVEPLNSPLLSKGEAGSHKIQGIGANFIPAILNKEVIDEVITVS
NEDAINTAKELAKSGLMVGISSGANVFAASMLAKKFPDKRILTMLNDTAERYLSTDLFA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatatgaaaaagtaagtgagcttataggaaatactcctattatacatttgaaa
aaatttggtatcaatgtttttgctaaatgtgaatttttaaatcctagtcattctataaaa
gatagagcagcttttgaaatgattaaagatgctttagatagtaaaaaaattaatcaagat
actacaatagttgaagcaactagtggaaatactggaatttctttggctatgatttgtgca
gatttgggacttaaatttattgctgtaatgcccgaatctatgagtttagaaagaagaaaa
atgataacactctttggcgctaggttagaattaactcctgcaaatttaggaatgaaagga
gcggttgataaagcaaatgaaatattattaaatactccaaattcttttatggtttctcaa
tttgaaaatatttcaaataaaaatgcgcatcgtaagaatacggctttagaaattttaaga
gatttggataatgaacttgatatttttgtagctggttttggaactggcggtactattagt
ggagttggggaaatactaaaagaaaaattagaaaaagtgcatattgttggagtcgagcct
ctaaattctccattgcttagcaaaggtgaagcgggaagccataaaatacaaggaataggg
gcgaattttatacctgctattttaaataaagaagttatagatgaagtgatcacagtaagt
aatgaagatgctataaatacagccaaagaacttgccaaaagtggtttaatggtaggtata
tcaagtggagcaaatgtatttgccgcaagtatgctagcaaagaaatttccagataaaaga
attttaactatgctaaacgatacggctgaaagatacctctcaactgatctttttgcttaa

DBGET integrated database retrieval system