KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0955Help
Entry
CJS3_0955         CDS       T01856                                 

Gene name
ciaB
Definition
(GenBank) invasion antigen B
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3916 DUF4194
Motif
Other DBs
NCBI-ProteinID: ADT72683
Position
complement(882471..884303)
Genome map
AA seq 610 aa AA seqDB search
MNNFKEIAKLVRKYKERNNALYEFLDKEDVGEYFRSLISLSELKQDKTTMLAILRRLVDL
KEENLAQEWKKNNFKEDKIIELKHKFYEEVRKFYEKEHQNLINEIKEKKLLNNFYQSLIQ
GVHNIGLIMNIFEISWTKEIIEKNNKILSTQFPNLDDAMEFLRKNHLYQKTPEGEICERS
YGVLVRIGNLWKFVPYARFFENEILKLEFAFENMIDQLKIFASSEEEKAYIEYFEKLKLA
FCEKDEDRVIKAWQEAEFAWMKVKSPLQVGHPLEYYEDNYTHAVALEWDIRIEDENDFDV
LKFGNEIKESFEHVYKNIGLEDCELEKEVLSNIEKTQLYICTPMIFYGAELKGLFSAQVV
PNDEFVSSKAGKKIFAFINFVYENAKTKPFMKISSEVFDKEFLDFGRNILFYQEKIWKRV
YEVSTIGHEFGHIFFIANDTEKTMNQSGFFKNIEEYKATTGGLINFFYHEQDDLIMPVFH
ELIKRAIGLISWQRVDEVKPYYTEGLIHLSLLFESEVLIFENNNLKINFDLRYYEKFKEL
TLKNYHELAKHYALRLDAKEFLSRFCEIEDNIFLPIMPKCKEFVKFYYDLYEKIGNEIDN
SGEFERYKKK
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaataattttaaagaaatagctaaattggttagaaaatacaaagaaagaaataatgcg
ttatatgagtttttagacaaagaagatgtgggcgagtattttagatctttgatttcttta
agcgaattaaaacaagataaaacaactatgctagccatacttaggcgtttggttgattta
aaggaagaaaatttagctcaagagtggaaaaaaaacaactttaaggaagataagattata
gagctaaaacataagttctatgaagaggttagaaagttttatgaaaaagaacatcaaaat
ttaattaatgaaataaaagagaaaaaacttttaaataatttttatcagtctttaatacaa
ggagtgcataatataggtttaattatgaatatttttgaaatttcttggactaaagaaatt
atagaaaaaaataataaaattttatctactcaatttccaaatttagatgatgcaatggaa
tttttacgtaaaaatcatttatatcaaaaaactccagaaggagaaatttgtgagcgaagc
tatggtgttttagttagaataggaaatttatggaaatttgttccttatgcgagatttttc
gagaatgaaattttaaaattagaatttgcttttgaaaatatgattgatcagcttaaaata
tttgctagcagcgaagaggaaaaagcttatatagaatattttgaaaaattaaaattagcg
ttttgtgaaaaagatgaagatagggttataaaagcttggcaagaagctgaatttgcttgg
atgaaagtaaaatcacctttacaagtgggacatcctttagaatattatgaagataattat
actcatgcggtggcattagaatgggatataagaatagaagatgaaaatgattttgatgtt
ttgaaatttggtaatgaaattaaggaaagttttgaacatgtttataaaaatataggactt
gaagattgtgaattagaaaaagaagttttatctaatatagaaaaaactcaactttatatt
tgcactccgatgatattttatggtgctgaacttaaaggtttattctcagctcaagtcgtt
ccaaatgatgagtttgtaagttctaaggcgggcaaaaaaatatttgcctttataaatttt
gtatatgaaaatgctaaaacaaagccttttatgaaaatttctagcgaggtttttgataaa
gaatttttggattttggaagaaatattttattttatcaggaaaaaatttggaaaagggtt
tatgaagtatcaactataggccatgaatttggtcatatattttttattgctaatgatacc
gaaaaaacaatgaatcagagtggtttttttaaaaatatagaagaatataaagctactaca
ggtggacttataaatttcttttatcatgaacaagatgacttgataatgcctgtttttcat
gagcttataaaaagagctattggacttatttcttggcaaagggttgatgaagttaaacct
tattatacggaaggacttattcatcttagcttgctttttgaaagcgaagtattgattttt
gaaaataataatttgaagataaattttgatttaaggtattatgaaaaatttaaagagcta
actttaaaaaattatcatgaattggcaaaacactatgctttaagacttgatgcaaaagag
tttttaagtagattttgtgaaattgaagataatatttttcttcctattatgcctaagtgt
aaagaatttgttaaattttattatgatttatacgagaaaattggtaatgaaattgataat
agtggagaatttgaaagatataagaaaaaataa

DBGET integrated database retrieval system