KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0957Help
Entry
CJS3_0957         CDS       T01856                                 

Definition
(GenBank) hypothetical protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sel_put
Motif
Other DBs
NCBI-ProteinID: ADT72685
Position
complement(884818..884958)
Genome map
AA seq 46 aa AA seqDB search
MVGLSSYDKYLEHMKQKHPGKIPKTRGEFFKECLDKKYNSGGLNKC
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
ttggtgggactttctagttatgataagtatttagaacacatgaaacaaaaacatccagga
aaaattccaaaaaccagaggggaatttttcaaagaatgtctagataaaaaatacaatagt
ggcggtttaaataaatgctga

DBGET integrated database retrieval system