KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0961Help
Entry
CJS3_0961         CDS       T01856                                 

Definition
(GenBank) Putative ABC-type amino-acid transporter permease protein
  KO
K10040  putative glutamine transport system permease protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs02010  ABC transporters
Module
cjs_M00228  Putative glutamine transport system
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CJS3_0961
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjs02000]
    CJS3_0961
Transporters [BR:cjs02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative glutamine transporter [MD:M00228] [OT]
    CJS3_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADT72687
Position
complement(888311..888970)
Genome map
AA seq 219 aa AA seqDB search
MENVFNAQNIEFLMQGLFLTLKIALATCIISIVFGTFLAITKNYGDRLSKFLAACYIDIF
RNTPLLLWMLAACFVLPVFFGQFPQAFWGTIGFSLYTSSVMAEIIRGGLNSIPKGQFEAA
YSQGFGKFFTLFYIILPQTFRKIIPALLSQIVTTVKDTAYLAGLGIAELTYNSKTILAKL
TSFEEILAMIGVVAGIYFIICFSLSMLVRYYAKKTAYIS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgtttttaatgcgcaaaatattgaatttttaatgcaaggtttatttctgaca
ttaaaaatagccttagcaacttgtattatttcgattgtttttggaacttttttagctata
actaaaaattatggggatagattaagtaaatttttagcagcttgctatatagatattttt
agaaatactcctttattattatggatgcttgcagcttgttttgttctacctgtatttttt
ggacaatttcctcaagctttttggggtactataggattttcactttatacgagttcggtt
atggctgaaattattagaggtggattaaattctataccaaaaggtcagtttgaagcagct
tattctcaaggttttggtaaattttttactcttttttatattattttaccacaaactttt
agaaaaataatacctgctttattatctcaaattgtaaccactgtaaaggatacagcttat
ttagcgggtttaggtatagctgaacttacttataattcaaaaactatattggcaaaacta
acaagttttgaagaaattttagcgatgataggtgttgttgcgggaatttattttataata
tgtttttcactttctatgttggtaagatattatgccaaaaagacagcttacatttcttaa

DBGET integrated database retrieval system