KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0967Help
Entry
CJS3_0967         CDS       T01856                                 

Gene name
rpiB
Definition
(GenBank) Ribose 5-phosphate isomerase B
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00030  Pentose phosphate pathway
cjs00051  Fructose and mannose metabolism
cjs01100  Metabolic pathways
cjs01110  Biosynthesis of secondary metabolites
cjs01120  Microbial metabolism in diverse environments
cjs01130  Biosynthesis of antibiotics
cjs01200  Carbon metabolism
cjs01230  Biosynthesis of amino acids
Module
cjs_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CJS3_0967 (rpiB)
   00051 Fructose and mannose metabolism
    CJS3_0967 (rpiB)
Enzymes [BR:cjs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     CJS3_0967 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB zf-LSD1
Motif
Other DBs
NCBI-ProteinID: ADT72693
Position
892924..893361
Genome map
AA seq 145 aa AA seqDB search
MLREKIYIASDHAGFELKEKICVFLKEKNIIFNDLGTNTCASCDYPDYAHLLAEKINKRS
FGILICGSGIGISIAANRHKNIRCALCHESLSAELARRHNDANVLALGGRLIGVELAIDI
IEKFIQTPFEEGRHMQRIQKIEVKI
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcttagggaaaaaatttatattgctagtgatcatgctggttttgaattaaaagaaaaa
atttgcgtatttttaaaagaaaaaaatataatttttaacgatttaggaacaaacacttgc
gcaagctgcgattatcctgattatgcgcatttacttgccgaaaaaataaacaaacggagc
tttggcattcttatttgtggaagtggaattggaatttctattgcagcaaatcgtcataaa
aacattcgttgtgcattatgccacgaaagcttaagtgcagaacttgcaagaaggcataat
gatgccaatgttttggcattaggcggaagattaattggggttgaattagctatagatatt
atagaaaaattcattcaaactccttttgaagaagggagacatatgcaaagaattcaaaaa
attgaggtaaaaatataa

DBGET integrated database retrieval system