KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0968Help
Entry
CJS3_0968         CDS       T01856                                 

Definition
(GenBank) membrane protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YabA DUF3450 MscS_porin UPF0242 FlaC_arch Atg14 DUF3867 DUF2353 ZapB Cluap1 DUF948 PRKG1_interact DUF1664 TSC22 FPP TLE_N DivIC Spc7 ATP-synt_8 Tfb5 FAM76 Cortex-I_coil
Motif
Other DBs
NCBI-ProteinID: ADT72694
Position
893361..893693
Genome map
AA seq 110 aa AA seqDB search
MFTNWLVLTILICATIYLIVMLFYYKTLLNKEKTSKDFIKNNLDDTEIVIRKLQIQLQRS
LGNIDILTEELNKIKADLTSLRTRNSQYRLENDKLRQRIKELEAKIEALL
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaaactggcttgttttaactatattgatttgtgcaactatctatcttattgta
atgttgttttactataaaactctacttaataaagaaaaaacatcaaaagattttatcaaa
aacaatcttgatgatactgagattgtcattagaaaactacaaattcaacttcaaagaagt
cttggaaatatagatatactcacagaagaacttaataaaatcaaagcagaccttacatct
ttaagaaccagaaattctcaatatcgcttggaaaatgacaaactaagacaaagaattaaa
gaattagaagcaaaaattgaggcattattatga

DBGET integrated database retrieval system