KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0969Help
Entry
CJS3_0969         CDS       T01856                                 

Gene name
apt
Definition
(GenBank) Adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00230  Purine metabolism
cjs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CJS3_0969 (apt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjs04147]
    CJS3_0969 (apt)
Enzymes [BR:cjs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     CJS3_0969 (apt)
Exosome [BR:cjs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CJS3_0969 (apt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Motif
Other DBs
NCBI-ProteinID: ADT72695
Position
893690..894238
Genome map
AA seq 182 aa AA seqDB search
MIKLTQEEQKYLLDSIRIIPDFPKKGIIFRDITTLLNNKEALNFLLKHLKERYKDYNLDF
IAGTESRGFIFASMICAKLNLPFVPIRKPGKLPFETFSCEYDLEYGSDKVELHKDAFKNI
QNARVLLVDDLIATGGTAIASYELIQKAGAKCVEACFLMNLKDLNGANKLEKLTSVYSVL
EI
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgataaaactaacacaagaagaacaaaaatacctgcttgatagcattaggattattcct
gattttccaaaaaaaggaattatttttagagatattaccactctactaaataacaaagag
gctttaaattttctacttaaacatttaaaagaacgctacaaagattacaatctagacttc
atagcaggaacagaaagcagaggatttatctttgcatctatgatttgtgcaaaacttaat
cttccttttgtgcctattagaaaacctggaaaactcccttttgaaacctttagctgcgaa
tacgatcttgaatatggcagcgataaagtagaacttcataaagatgcatttaaaaatatt
caaaatgcaagagttttacttgtagatgatttaatagcaactggcggaacagctatagct
tcatatgaactcattcaaaaagctggagcaaaatgtgttgaagcttgttttttaatgaat
cttaaagatttaaatggagcaaataaacttgaaaaacttacttcagtttatagtgtttta
gaaatttaa

DBGET integrated database retrieval system