KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0970Help
Entry
CJS3_0970         CDS       T01856                                 

Definition
(GenBank) membrane protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc MatE
Motif
Other DBs
NCBI-ProteinID: ADT72696
Position
894257..894853
Genome map
AA seq 198 aa AA seqDB search
MEEFLKNLLYQYKDLAYIIIFLWCILEGELALILAGIFAHQGHVNLGFVIFIAGLGGFVG
DQIYFYIGRYNKCYIQKKLKTQRRKFAVAHLLLQRFGWPIIFIQRYMYGFRTIIPMSIGI
TRYSAKKFAIINLFSAWVWASITILLAWYFGEQIWKMVTWAEEHWYYAAIIIIAFLSLLL
FGFKQMEKAILKDKRKKS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatttttaaaaaatttactttaccaatacaaagatctagcttatattattatt
tttttatggtgcattttagaaggagagttagctttaattttagctggtatttttgcccat
caaggacatgtaaatttaggctttgttatatttatagcaggtcttggcggttttgtaggc
gatcaaatttacttctatataggaagatataataaatgctacatacaaaaaaaattaaaa
actcaaaggcgtaaatttgcagtagcacacctacttttacaacgttttggttggcctatt
atttttatacaacgctatatgtatggctttagaaccattatacctatgagtataggaatc
acgcgttatagtgcaaaaaaatttgctattatcaatctttttagtgcttgggtttgggca
tcaatcactatacttttagcttggtattttggagaacaaatttggaagatggtgacttgg
gctgaagaacattggtattatgcagccattattattatagcttttttatcccttttatta
tttggttttaaacaaatggaaaaagctatacttaaagataaaaggaaaaaatcatga

DBGET integrated database retrieval system