KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0971Help
Entry
CJS3_0971         CDS       T01856                                 

Gene name
pepA
Definition
(GenBank) Cytosol aminopeptidase PepA
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00480  Glutathione metabolism
cjs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CJS3_0971 (pepA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjs01002]
    CJS3_0971 (pepA)
Enzymes [BR:cjs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     CJS3_0971 (pepA)
Peptidases [BR:cjs01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   CJS3_0971 (pepA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: ADT72697
Position
894850..896301
Genome map
AA seq 483 aa AA seqDB search
MKFELNDKKLDAIKADFELVFIQDKNLKIFNKEKDFFKLNNYKGEGALLDLNNKKLYLEL
KSLAYEDIRLSLCTAYKTLEKLNIKSVKLPSIIGDCVVRSFASLVEGVLFGAYKFDKYKS
EKKTSTLEKFIISNEELNGKKFNKDEAKIGLERGEILANATNFTKNIVNEIPEIYTPLKM
AEDAQNLAKENKNIICKIYDEKFLAKEKMNAFLAVNHASVHPPRLIHLSYKAKNAKKRVV
FVGKGLTYDSGGLSLKPADFMLTMKADKSGAAAAMGIIKAVAELALDLEVHCILGATENM
IGGNAYKPDDVLISREGVSIEVRNTDAEGRLVLADCLSFAQDLKPDLLIDMATLTGACVV
GLGEFTSAIMGNNEELQNDFYLSSKKSGEYTTILHFNPHLRELIKSNIADVSNTASSRYG
GAITAGLFLDKFIRKEYKDKWLHLDIAGPAYTEKSWGYSSFGAGGAGVRMCVNYLIQILR
KAK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaattaaacgataaaaaactagatgctataaaagcagactttgaacttgtt
tttatacaggataaaaatttaaaaatttttaacaaagaaaaagatttttttaaacttaat
aattacaaaggcgaaggtgcattattagacttaaacaataaaaagctttatttagagctt
aaaagtcttgcttatgaggatataagattaagtctttgcacagcatataaaactcttgag
aaacttaatattaaaagcgtaaaacttcctagcataataggagattgtgtagttagaagt
tttgcatctttagttgaaggcgtactttttggagcttataaatttgacaaatataaaagc
gagaaaaaaacaagtactttggaaaaatttattatttcaaacgaagaattaaatggtaag
aaatttaataaagatgaagctaagataggtttagagcgtggagaaattttagccaatgct
acaaattttactaaaaatatagtcaatgaaattcctgaaatttacacccctttaaaaatg
gcagaagatgcgcaaaatttagctaaagaaaataaaaacattatttgtaaaatttatgat
gaaaaatttttagccaaagaaaaaatgaatgcctttttagcggtaaatcatgcctcggta
cacccaccacgcctcattcatctaagctataaagccaaaaatgcaaaaaaacgtgttgta
tttgttggaaaaggcttaacttacgatagcggtggattaagcttaaaaccagctgatttt
atgcttacaatgaaagctgataaaagcggtgcagcagcagcaatgggaatcataaaagcc
gtagctgaacttgctttagatttagaagtgcattgcattttgggcgcaactgaaaatatg
ataggcggcaatgcttataagcctgatgatgtgttaatcagtcgtgaaggtgtaagcata
gaagtaagaaatacagatgcagaaggacgcttggttttagctgattgtctttcttttgca
caggatttaaaacctgatttacttatcgatatggcaactcttactggagcttgtgttgta
ggacttggagaatttacaagcgctattatgggaaataatgaggaattgcaaaatgatttt
tatctaagctctaaaaaaagcggagaatataccacaatcttacatttcaaccctcactta
agagaacttataaaatcaaatattgccgatgttagtaatactgcctctagtcgctacgga
ggtgcaattaccgcagggttatttttagataaatttattcgtaaagaatataaagataaa
tggctacatcttgacatagcaggacctgcttatacagaaaaatcttggggatattctagt
tttggcgcaggtggagctggagttagaatgtgtgttaattatttaattcaaattttaagg
aaagctaaatga

DBGET integrated database retrieval system