KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0975Help
Entry
CJS3_0975         CDS       T01856                                 

Definition
(GenBank) Pyruvate carboxyl transferase subunit B
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00020  Citrate cycle (TCA cycle)
cjs00620  Pyruvate metabolism
cjs01100  Metabolic pathways
cjs01120  Microbial metabolism in diverse environments
cjs01200  Carbon metabolism
cjs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJS3_0975
   00620 Pyruvate metabolism
    CJS3_0975
Enzymes [BR:cjs01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     CJS3_0975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA Biotin_lipoyl HMGL-like Biotin_lipoyl_2 HlyD_D23 HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADT72701
Position
complement(900402..902201)
Genome map
AA seq 599 aa AA seqDB search
MAKKFIDVMDTSFRDGFQSVYGARVLMDDFFPAVEAAKEAGITHFEFGGGARFQSLYFYL
NEDAFTMMDRFRAIVGKDANLQTLARGVNTVTLDTGNSELIDLHAKLFAKHGTTTIRNFD
ALNDVNNLKFSGECIVKHGLKHEITITLMDLPSNCKGAHDVPFYEKILKEILTAEIPFHS
ICFKDASGTSNPNKIYKTIKMARKILPQDTHIRLHTHETAGVSIACYLAALEAGVDGIDL
AAAPVSGGTSQPDILTMMHALKGKDYDLGGLEEEKILRYEEVLKDCLKEYFLPPEATMVN
PLIPFSPMPGGALTANTQMMRDNNILDKFPQVIHAMREVVEKGGFGTSVTPVSQFYFQQA
FNNVMFGPWKKIAEGYGKMVLGYFGKTPVTPDANIVELASKQLNLEPTTELAINIADKDE
SKSIAYTKTLLEKEGIETSEENIFIAAACKEKGIAFLKGEAKVNIRKLASMPKPMSVDEN
KFTVAVNGNKYHVEVSYGFDKDVNVKSVKKVEENKNIISSNSTSSVDAENEILAGISGNV
FKIYVNEGEEVKSGQAIMVLEAMKMEIEVNAPKDGIISELCIKIGDTVNEGEVLAIYKN
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaattcatcgatgtaatggatacaagctttagggacggttttcagtctgtt
tatggagctagggttttaatggatgatttttttcctgcagtagaagcagcaaaagaagcg
ggtattactcattttgaatttggtggtggtgctagatttcaaagcttgtatttttatctt
aatgaagatgcttttaccatgatggatagatttagggctattgtaggaaaagatgctaat
cttcaaactttagcaagaggagtcaataccgttactttagatactggaaatagtgaactt
attgatttgcatgcaaaactttttgcaaaacacggtactacaacgataagaaattttgat
gcccttaatgatgtaaataatttaaaatttagtggtgaatgtatagtaaaacatgggtta
aagcatgaaattactattactttaatggatttaccgtcaaattgcaaaggtgctcatgat
gtgcctttttatgaaaaaattttaaaagaaattttaacagcagaaattccttttcatagt
atttgtttcaaagatgcaagtggaacttctaatccaaataaaatttataaaaccattaaa
atggctagaaaaattttacctcaagatacacatattagacttcatacgcatgaaactgca
ggggtgagtatagcttgctatcttgcagcgcttgaagcaggggttgatggtattgatttg
gctgcagctcctgtaagtggtggaacttctcagcctgatattttaaccatgatgcatgct
ttaaaaggcaaagattatgatttaggtggacttgaagaagaaaaaattttaagatacgaa
gaagttttaaaagattgtttaaaagagtattttttaccacctgaagctactatggtaaat
ccacttattcctttttctcctatgccaggaggagctttaacagcaaatacacaaatgatg
agggataataatattttagataaatttccacaggtcattcatgctatgagagaagttgtg
gaaaaaggtggatttggtacttcggttactccagtttctcaattttattttcaacaagca
tttaataatgttatgtttgggccttggaaaaaaatcgcagaaggttatggaaaaatggtg
cttggttattttggaaaaactccagttacacccgatgcaaacattgttgaacttgcttca
aaacaacttaatttagaacccactacagagcttgctattaatatagccgataaagatgag
agtaaaagcatagcttatactaaaaccttgcttgaaaaagagggtatagaaacgagtgaa
gaaaatatatttattgcagcagcttgtaaagaaaaaggtatagcatttttaaaaggagag
gcaaaggtaaatatacgcaaattagctagcatgccaaagcctatgagtgtagatgaaaac
aaatttactgtagctgtaaatggtaataaatatcatgtggaagtgagttatggttttgat
aaagatgttaatgttaagagtgtaaaaaaagtagaagaaaataaaaatattatttcttca
aattcaacaagttctgtcgatgctgaaaatgaaattttagcaggtatttcaggtaatgtc
tttaaaatttatgttaacgaaggcgaagaagtaaaatcaggtcaagctatcatggtttta
gaagcaatgaagatggagattgaggttaatgccccaaaagatggaattatttcagagctt
tgtattaaaataggtgatactgttaatgaaggcgaagtattagctatttacaagaattaa

DBGET integrated database retrieval system