KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0980Help
Entry
CJS3_0980         CDS       T01856                                 

Gene name
aas
Definition
(GenBank) Putative 2-acylglycerophosphoethanolamine acyltransferase / acyl-acyl carrier protein synthetase
  KO
K05939  acyl-[acyl-carrier-protein]-phospholipid O-acyltransferase / long-chain-fatty-acid--[acyl-carrier-protein] ligase [EC:2.3.1.40 6.2.1.20]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CJS3_0980 (aas)
   00564 Glycerophospholipid metabolism
    CJS3_0980 (aas)
Enzymes [BR:cjs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.40  acyl-[acyl-carrier-protein]---phospholipid O-acyltransferase
     CJS3_0980 (aas)
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.20  long-chain-fatty-acid---[acyl-carrier-protein] ligase
     CJS3_0980 (aas)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding MFS_1 Acyltransferase MFS_3 GalKase_gal_bdg Ribosomal_L14e
Motif
Other DBs
NCBI-ProteinID: ADT72706
Position
complement(906727..910239)
Genome map
AA seq 1170 aa AA seqDB search
MQKKSFLKIYGLIPFLLIAFINAFVDLGHKIIIQNTIYKAYEGSEQLFLNAIVNALILLP
FILMLSPSGFLADKYPKNIVMKISAIFNVILTLIICICYYSGAFWMAFIFTFIMGAQAAI
YSPSKYGFIKELVGKDFLAMGNGVINAVSIVAILAGMALFSLSFESLYSSMYNQTDEILK
EVAPLGIVLILFSCIEVFFAWRLPKLKQTNKDLVFNKKDYIRGKLLINNLKLVFKNKTIW
LCIIGISFFWAISQLYLVSFPVFAKNELFIENTFYVQISLAFSGIGVILGSLVAGKFSKN
YIELGFIPLGALGMFLMAFLMPYFISLLSYSFLFFFFGFCGALFIIPLNTLIQFHAKENE
LGQILAGNNFFQNIAMLGFLLLATLFAKFEINVIYLFYFIALVTFIGSFYILLKLPFSLV
RILLSIAFLQRYRLLVEGFENIPEKGGALLLGNHISFIDWAVVQMAIPRKIYFVMERSIY
SKWYIKIFLDKFGIIPVSSTGSKTSLELIAKHIKEGNLVCLFPEGTLSRHGQLNEFKAGF
ELACECLSEDDGKIIPFYIRGLWGSAFSRSDEEFSARNRTLNKRKIAIAFGKAMPLHSKK
DEVKAKVFELSFMAWKSQCEAMHTIARAWIDTAKKNLNQIAIIDTLAGDISYRKMLTLSL
FLNFFIKRKSKELNINPQRGSYAPKEEAIGILLPASFASSLTNLSVLIAEKIAVNLNFTA
GEKALKAAIKNAQISQIYTSKTFLEKLANKGINLNFDTNIHLIYFENIVEDFKMQKTKIF
SMMLAVSIIPSFILKSIFTPSKNNLAIAAILFSSGSEGSPKGVMLNNRNILSNIAQISDV
LCTRNNDVILSSLPPFHAFGLTVTTFLPLLEGIKSITFSDPTDALGVAKAVAKNNVTIMC
GTSTFLGIYARNKKLDALMFESLRIVVSGAEKLKNEVRTTFEMKFKKSIFEGYGATETTP
VASVNLPNHFDVDYWLIHRANKEGSVGMPLPGTAVRIVNPNNYENLKTNEDGLILIGGHQ
VMVGYLNDKEKTDEVVKEIDGIRWYNTGDKGHLDEDGFLYIVDRYSRFAKIGGEMISLGA
IEEEIAKFIDTEVVKFCATSLEDEKKGEQIVLLIECNNEIFEGVCEAIKNSNIPTLFKPR
YYFQIEKIPLLGSGKVDLKKVKELAKNLAI
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaatcttttttgaaaatttacggattaattccttttttacttatagcattc
atcaatgcttttgtggatttgggacataaaattattattcaaaatactatttataaggcc
tatgaaggaagtgagcagttatttttaaatgctatagttaatgctttgattttacttcct
tttattcttatgctttctccttcgggttttttagcggataaatatccaaaaaatattgta
atgaaaatttcagcaattttcaatgttatactcactttaataatttgcatttgttactat
agcggtgctttttggatggcttttatttttacttttataatgggagcacaagcagcgatt
tattcaccaagtaaatacggttttattaaagaactcgtgggaaaagactttcttgctatg
ggtaatggtgtaattaatgcggtaagcattgtggcaatcttagcgggaatggctttattt
tctttaagctttgaaagtctttatagttctatgtataatcaaacagatgaaattttaaaa
gaagtagcgcctttaggaattgtgctaattttattttcttgtatcgaagtattttttgcg
tggcgtttacctaagctcaaacaaacaaataaagatttagtttttaataaaaaagattat
atccgtggaaaacttctaataaataatcttaagcttgtttttaaaaataaaactatttgg
ctttgtataattggaatttcatttttttgggctatatctcaactttatcttgtcagcttt
cctgtctttgctaaaaatgaacttttcatagaaaatactttttatgtgcaaatttcactc
gctttttctggtataggagtgattttaggctctttagtagctggtaaattttcaaaaaat
tatatagaacttggatttattccacttggtgcattgggtatgtttttaatggctttttta
atgccttattttataagtttattaagttatagttttttatttttcttttttggattttgc
ggagccctttttatcattcctttaaatactttaatccaatttcatgctaaagaaaatgaa
ttaggacaaattcttgcaggaaataatttttttcaaaatattgccatgttaggattttta
ctcttagcaactttatttgcaaaatttgaaatcaatgtgatttatttgttttattttatt
gctttggtaacctttataggaagtttttacatacttttaaaactccccttttctttagtg
cgtatacttttaagcatagcttttttacaacgataccgtttacttgtggaaggttttgaa
aatataccagaaaaaggtggagctttacttttgggtaatcatatttcttttattgattgg
gctgttgtacaaatggcaattccaagaaaaatttattttgttatggaaagaagtatttat
tctaaatggtatattaaaatttttcttgataaatttggtattattcctgtatcaagtaca
ggaagtaagacgagtttagaactgatagcaaagcatattaaagaaggtaatttagtttgc
ttatttcctgaaggtacactttcgcgacatgggcaattaaatgaatttaaagcaggattt
gaattagcttgtgaatgtttaagtgaagatgatggaaaaattattcctttttatataaga
gggctttggggtagcgctttttcaagaagtgatgaagaattttcagcaagaaaccgcact
ttaaataaaagaaaaattgctatagcttttggtaaagctatgcctttgcattctaaaaaa
gatgaagttaaagctaaagtttttgaactttcttttatggcttggaaatcacaatgcgaa
gctatgcatactatagcaagagcttggatagatacagctaaaaaaaatctaaatcaaata
gctattatcgatacactagctggagatatttcttatagaaaaatgttgactcttagttta
tttcttaatttttttattaaaagaaaatccaaagaattaaacattaaccctcagcgtgga
agttacgctcctaaagaggaagctataggaattttactacctgcttcttttgcaagttct
ttaaccaatctatctgttttaatcgcagaaaaaattgcagtaaatcttaatttcactgct
ggagaaaaagctctaaaagcagctataaaaaatgcgcaaatttcacaaatttatacttct
aaaacttttttagaaaaattagcaaataaaggtataaacctaaatttcgatacaaatata
catttaatttattttgaaaatattgtagaagattttaaaatgcaaaaaactaaaattttt
agcatgatgctagcagttagtattatacctagttttatactcaaaagcatcttcactcct
tcaaaaaacaatcttgccatcgcagctattttatttagtagtggaagtgaaggttctcca
aaaggtgttatgctcaataaccgtaatattttaagcaatatagcacaaatttctgatgtg
ctttgcacaagaaataatgatgtcattctctcatctttaccaccttttcatgcttttgga
cttaccgtaactacatttttgcctttgcttgaaggtattaaaagcatcactttttcagat
ccaaccgatgccttaggggttgccaaagctgttgctaaaaataatgtcactattatgtgt
ggaacttcaacctttttaggaatttatgcaagaaataaaaagcttgatgctttaatgttt
gaaagtttaagaatagttgtatcgggcgctgaaaaactaaaaaatgaagtaagaactact
tttgaaatgaagtttaaaaaaagtatttttgaaggttacggggctacggaaaccacgcct
gtggcgagtgtaaatttaccaaatcattttgatgtggattattggcttatacatcgtgcc
aataaagaaggaagcgtaggaatgcctctacctggaactgcggtacgtattgttaatcca
aataattatgaaaatttaaaaacaaatgaagatggactcatacttataggcggtcatcaa
gttatggtaggctatcttaatgacaaagaaaaaaccgatgaagtggttaaagaaattgat
ggcataagatggtacaacacgggagataagggacatttggatgaagatggttttttatat
attgtcgatcgttattctcgctttgcaaaaattggcggagagatgatttctttgggtgca
atagaagaagaaattgccaaatttatagacactgaagtggttaaattttgtgccacatct
ttagaagatgagaaaaaaggggaacaaattgttttactcatagaatgcaataatgaaatt
tttgaaggagtatgtgaggctataaaaaattctaatatacctacactttttaaacctaga
tattattttcaaatagaaaaaattcccctcctaggttcaggaaaagttgatcttaaaaaa
gttaaagaattagctaaaaatttagccatataa

DBGET integrated database retrieval system