KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0982Help
Entry
CJS3_0982         CDS       T01856                                 

Definition
(GenBank) Putative glutamine transport system permease
  KO
K02029  polar amino acid transport system permease protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Module
cjs_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjs02000]
    CJS3_0982
Transporters [BR:cjs02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    CJS3_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADT72708
Position
complement(911465..912250)
Genome map
AA seq 261 aa AA seqDB search
MSLFIQKNKNFKPLKPLSKSKIITNLILLILFLILFCYCSFSVSAYHFDFSAIATYKEKF
LQGFLNTLIISFFSLLLSIILGGVFCAFSLSSIVFLRFLSTFYIELIRGTPLLVQVLLIY
YIIANNLGLDNRYVAGVIILSCFSAAYLAEIFRAGILSISISQLESARALGLKEMQVFAY
VIFPQALKNILAPLSGQFANLIKDSSLLSVIAVNELTQSAQEINSYTFATLEAYVILAIT
YLVLTLPISIFSRYLERKCQK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttgtttattcaaaaaaataaaaattttaaacctttaaaacctctatcaaagtca
aaaataatcaccaatttaattcttttgattttatttttaatattgttttgttattgtagt
tttagtgtaagtgcttatcattttgattttagcgcaattgcgacctataaagaaaaattt
cttcaaggttttttaaatactttaataatcagttttttttctttattgttgagtataatt
ttgggtggagttttttgtgctttttctttaagttcgattgtttttttaagatttttatct
acattttacatagagcttatcagaggaacccctttactagtgcaggtattattgatatat
tatatcattgcaaataatttaggacttgataatcgatatgtggctggagttattatttta
tcatgtttttctgctgcttacttagctgaaatatttagagctggaattttaagtatttct
atatctcagcttgagagcgctagggctttagggttaaaagagatgcaggtttttgcgtat
gtaatttttccccaagctttaaaaaatattttagcaccactgagtggacaatttgcaaat
ttaattaaagatagttccttattaagcgttattgctgtaaatgaattaacccaaagtgcg
caagagataaattcttatacttttgctactcttgaagcttatgtaattttggctattaca
tatcttgttttgactttacctataagtatattttctcgttatttggagagaaaatgccaa
aaatga

DBGET integrated database retrieval system