KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0983Help
Entry
CJS3_0983         CDS       T01856                                 

Definition
(GenBank) Lipoprotein releasing system transmembrane protein LolC
  KO
K02004  putative ABC transport system permease protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Module
cjs_M00258  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjs02000]
    CJS3_0983
Transporters [BR:cjs02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    CJS3_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX MacB_PCD Got1
Motif
Other DBs
NCBI-ProteinID: ADT72709
Position
complement(912273..913478)
Genome map
AA seq 401 aa AA seqDB search
MNKSVLKYLLFKYLRFDKEQPFINLSMLLAFLGVCVGLCVLLVAMAIMNGFDKEFEKRFF
VMNYPITILPKFYAPVNDEFIDELRKTFPNLLFSPYISTQVVVKGDNRFEGGVLFGVNFN
DEKKINEVVAKALKDENLSGFDILVGSALTDEFGLHKNDKLSLIFSNLNPSGFSLIPQTK
RFDVKARFTSGLAFYDKAYMYTDVDALKKVLGMPKNPNYDGIHVYSDNAFKDVEKIKSYL
KDDYAVVGWWEQNKNFFSALELEKRALFIVLMLIILVASLNIVSSLLMIVMNRRSEIALL
LALGASKNEVKKSFFALGMLIGGGGMIVGVVLAFFALWLLGNFDIVTLPADVYGTSKLPL
DLSLMDFSLTIVGALIIIALSSFYPAKKATQINILDTLRNE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaagcgttttaaaatatttactttttaaatatttaagatttgataaagaacaa
ccctttatcaatctttctatgcttttggcctttttaggagtttgtgtaggactttgcgtt
ttgcttgtagctatggcaattatgaatggttttgataaagaatttgaaaaacgctttttt
gtgatgaattatcctattactattttgcctaaattttacgctcctgtaaatgatgaattt
atagatgagttaagaaaaacatttccaaatttgttatttagcccttatataagcactcaa
gttgttgtaaagggagataatcgttttgaaggtggtgtgctttttggcgttaattttaat
gatgaaaaaaaaataaacgaagtggttgctaaagctttaaaggatgagaatttaagtggt
tttgatatacttgtaggatcagcacttaccgatgaatttggtttgcataaaaatgacaaa
ctttcacttattttttcaaatcttaatcctagtggattttctttaataccgcaaactaaa
cgttttgatgttaaagcgcgttttacttcagggcttgcattttatgataaagcttatatg
tatacagatgttgatgcattgaaaaaagtacttggaatgcctaaaaatccaaattatgat
ggaattcatgtatatagtgataatgcttttaaagatgttgaaaaaattaaatcttattta
aaagatgattatgctgtggtaggttggtgggaacaaaataaaaatttcttttcagcctta
gaacttgaaaaaagagcgctttttatagtgttgatgcttattattttggttgcaagttta
aatatagtaagttctttattgatgatagtaatgaatcgtcgcagtgaaatagcactttta
cttgctctaggtgcaagcaaaaatgaggtaaaaaagagtttttttgccttaggtatgctt
attggtggtggtggtatgatagtgggtgtggtgcttgcattttttgctttatggctttta
ggaaattttgatattgtaactttacctgctgatgtttatggaactagtaaattaccactt
gatttgtctttaatggatttttctttaaccattgtgggtgctttaataatcatagcttta
tcatctttttatcctgcaaaaaaagcaactcaaattaatattttagatactttaagaaat
gaataa

DBGET integrated database retrieval system