KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0986Help
Entry
CJS3_0986         CDS       T01856                                 

Definition
(GenBank) Putative periplasmic protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliL Topoisom_I_N
Motif
Other DBs
NCBI-ProteinID: ADT72712
Position
complement(916669..917403)
Genome map
AA seq 244 aa AA seqDB search
MKKIFLSVFLVLSLNAQNLEIDKIRTDLYSKSGTNVLKKVEISLEFDGNNLKENENKLID
AVNTVISGFFYEDIFTEIGKNNFKKTLEKFLDKKYKIELDDIYIISLSGVEKFDLEEFKR
FLESTEAKEKGMGSEVKKALKNLEVPKTQVPSVEKIPTPSVPNLEVKQVEQLFKDPDEEN
KNDNGEINIDNLNTPKMTPDIEEKIKRDLIANPPQIFKENNASKPYHLPQTGYDIKLDEN
STQN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatttttaagtgtttttttggttttgagtttaaatgctcaaaatcttgaa
atagataaaataagaacagatttgtattctaaaagtgggacaaatgttcttaaaaaagtc
gaaatttctttggaatttgatgggaataatttaaaagaaaatgaaaataagttaattgat
gctgtaaatacagtaatttcagggtttttttacgaagatatttttacagaaattggaaaa
aataatttcaaaaaaactttagaaaaatttttagataagaagtataagattgaattagat
gatatatatatcatatctttaagcggagtggaaaaatttgatttagaggagtttaaacgc
tttttagaaagtactgaggctaaagagaagggtatgggcagcgaggtaaaaaaagcactt
aaaaacttagaagttcctaaaactcaagttcctagtgttgaaaagatcccaactcctagt
gttccaaatttagaagtcaagcaagttgaacagcttttcaaagatccagatgaagaaaat
aaaaatgacaatggagaaatcaatatagataatttaaatacacctaaaatgactccagat
atagaagaaaaaattaaaagagatttaatcgccaatcctccacaaatattcaaagaaaat
aacgcaagcaagccttatcatttaccacaaacaggctatgatataaagcttgatgaaaat
tcaacgcaaaattag

DBGET integrated database retrieval system