KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0989Help
Entry
CJS3_0989         CDS       T01856                                 

Definition
(GenBank) N-carbamoylputrescine amidase
  KO
K12251  N-carbamoylputrescine amidase [EC:3.5.1.53]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00330  Arginine and proline metabolism
cjs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CJS3_0989
Enzymes [BR:cjs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.53  N-carbamoylputrescine amidase
     CJS3_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ADT72715
Position
complement(920163..921035)
Genome map
AA seq 290 aa AA seqDB search
MKIALIQQKFHLNKEQTIKKTCEFIEEASKQGAELVCLGELHQSEYFCQSENVDFFDYAN
DYEKDVKFWANIARKNQIVLIASLFEKRSAGLYHNTAVVFEKDGSIAGKYRKMHIPDDPC
FYEKFYFTPGDLGFEPINTSLGKLGVLICWDQWYPEAARIMALKGAEILIYPTAIGWFDK
DKDEEKQRQLNAWLGVQKGHAIANGLYVVAINRVGFEKDVSGVEEGIRFWGNSFVFGPQG
EELCLLDSQNECVKIIEIDKKRSENVRRWWPFLRDRRIEYFADLTKRFID
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgctttaatacaacaaaaatttcatttaaataaagaacaaactataaaaaaa
acttgcgaatttatagaagaagcctctaaacaaggagctgagcttgtttgcttaggagaa
cttcatcaaagtgagtatttttgtcaaagtgaaaatgtggatttttttgactatgctaat
gattatgaaaaagatgtgaaattttgggcaaatatagctagaaaaaatcaaatagtgctt
attgcttcattgtttgaaaaacgaagtgccggactttatcataatactgcagtggttttt
gaaaaagatggttctatagcaggcaaatatcgcaaaatgcacatacccgatgatccttgt
ttttatgaaaaattttattttactcctggagatttgggttttgaacctataaatacaagt
ttaggtaagcttggagtgcttatttgttgggatcagtggtatcctgaagcagcaagaatt
atggctttaaaaggagctgagattcttatttatcccacggcaattggttggtttgataag
gataaagatgaagaaaaacaaagacagctcaatgcttggcttggcgtacaaaaaggacat
gctatagctaatggtttatatgtagtagctatcaatagggtaggttttgaaaaagatgta
agcggggtagaagagggcattagattttggggaaattcttttgtttttggccctcaaggt
gaagaactttgtcttttagattctcaaaacgaatgtgtaaaaatcatagaaatagataaa
aaaagaagtgaaaatgtgcgtcgttggtggccttttttgcgagatagacgcatagaatat
tttgcagatttaactaaaagatttattgattaa

DBGET integrated database retrieval system