KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0990Help
Entry
CJS3_0990         CDS       T01856                                 

Definition
(GenBank) Cobalt-zinc-cadmium resistance protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux ZT_dimer
Motif
Other DBs
NCBI-ProteinID: ADT72716
Position
complement(921032..921919)
Genome map
AA seq 295 aa AA seqDB search
MSLQKKATLVASLCAIVLALVKFIVGLTSGSVAVLSSAIDSLMDFAISAFNFLALKKSSQ
KANENYNFGFSKIEALMGLLEGVFIVGVGIFIFYESILKIYYKEEIKDLNSSIYVMIFAL
IMTFFLVLFLNYVAKKTKSLIIESDALHYKTDCLTNACTLGALVLIYFTNLHIIDAIFGI
VISLYTAFSAFKIIKKALAFLMDEALPKEQVDKICTLISNNPEIISYHELKTRKTPSCNY
LSVHLVFCPIISLLNAHKISDEIEEGVRKMFENEKWDIQIHLDPYDDAEQERQRQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgcaaaaaaaagcaactcttgtagcaagtttatgtgccattgttttagccttg
gttaaatttatagtaggcttaacaagtggttctgttgcagtactttcaagtgcgattgat
tctttaatggattttgctatttctgcttttaattttttggctcttaaaaaaagctcacaa
aaggcgaatgaaaattataattttggtttttctaaaattgaagctttaatgggtttgtta
gaaggtgtttttatagttggcgtggggatttttattttttatgagagtattttaaagatt
tattataaagaagaaattaaagatttaaattcaagcatctatgtgatgatttttgcttta
attatgactttttttcttgtactttttttaaattatgtagctaaaaaaaccaaaagttta
attatagaaagtgatgctttgcattacaaaacagattgcttaaccaatgcttgtacttta
ggggctttggttttgatttattttacaaatttacatattattgatgctatttttgggata
gtgatcagtctttatacggcattttctgcttttaaaatcattaaaaaagctttagctttt
ttaatggatgaggctttacctaaggaacaagtggataaaatttgtactttgatttctaat
aatcctgaaataatttcctatcatgaattaaagacgcgtaaaactccaagttgtaattat
ttaagcgtgcatttggttttttgccctataatttcgcttttaaatgcgcataaaatttca
gatgaaatagaagaaggtgtgcgtaagatgtttgaaaatgaaaaatgggatatacaaatt
catttagatccttatgatgatgcagaacaagaaaggcaaagacaatga

DBGET integrated database retrieval system