KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1502Help
Entry
CJS3_1502         CDS       T01856                                 

Gene name
algC
Definition
(GenBank) Phosphomannomutase / Phosphoglucomutase / Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00010  Glycolysis / Gluconeogenesis
cjs00030  Pentose phosphate pathway
cjs00051  Fructose and mannose metabolism
cjs00052  Galactose metabolism
cjs00230  Purine metabolism
cjs00500  Starch and sucrose metabolism
cjs00520  Amino sugar and nucleotide sugar metabolism
cjs00521  Streptomycin biosynthesis
cjs01100  Metabolic pathways
cjs01110  Biosynthesis of secondary metabolites
cjs01120  Microbial metabolism in diverse environments
cjs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJS3_1502 (algC)
   00030 Pentose phosphate pathway
    CJS3_1502 (algC)
   00051 Fructose and mannose metabolism
    CJS3_1502 (algC)
   00052 Galactose metabolism
    CJS3_1502 (algC)
   00500 Starch and sucrose metabolism
    CJS3_1502 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    CJS3_1502 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    CJS3_1502 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CJS3_1502 (algC)
Enzymes [BR:cjs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CJS3_1502 (algC)
    5.4.2.8  phosphomannomutase
     CJS3_1502 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: ADT73205
Position
complement(1397694..1399064)
Genome map
AA seq 456 aa AA seqDB search
MLDVIFREYDIRGLYGKELNEKSVKAIGFCLGQTMLNKGCKNVSVGYDARYSANELFNYL
VSGLNKAGIKIYDIGLAPTPLGYFSLYEGLKFDANVMITGSHNPKDYNGFKITINKESFF
GVELKEFSKEVYKHLNDDIEENLEVEKYDILSLYVKFICEQFSFLKDFNYKFGVDCTNGA
AGVVIEPLIKALNLKAHVMFAEPDGQFPNHAPDPTEEENLSAIREFLNQNQDYSLAFAFD
GDADRMVALSKTHVFCGDELCYLFAKNIPNPRILGEVKCSKNLFDEVAKFGTIFMGKTGH
SNIKKMMKEKDIDLAAEVSGHIFFKHRYFGYDDGIYAFLRALELVYKGFDLESMIRALPK
LYTTPEIKIPVNEEEKFKLVEEFQKEIEKGALKGVKSLCEIDGARIDFGDGWALLRASNT
SPYLITRFEATSLERAKELESMVFTLFDDIKARFKN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgtgatttttagagaatatgatataagaggactttatggcaaagaactgaat
gaaaaaagcgttaaagctataggtttttgcttgggacaaaccatgctaaataaaggctgt
aaaaatgtaagtgtgggctatgatgcaagatatagtgcaaatgagctttttaattatctg
gtgagtggacttaacaaagcgggaataaaaatctatgatatagggcttgcgccaactcca
ttggggtattttagtctttatgagggcttgaaatttgatgcaaatgttatgataacaggc
tctcataacccaaaagattataatggttttaaaatcactatcaataaagaaagttttttt
ggcgtagagttaaaagagttttcaaaagaagtttataagcatttaaatgatgatattgaa
gaaaatttagaagtagaaaaatacgatattttaagcctttatgtgaaatttatatgtgag
caatttagctttttaaaggattttaattataaatttggtgttgattgtacaaatggtgcg
gctggagtagtgatagagcctttaatcaaggctttaaatttaaaagctcatgtaatgttt
gcagagcctgatggacagtttccaaaccatgccccagatcctacagaagaagaaaactta
agtgcgattagagaatttttaaatcaaaatcaagattattctttggcttttgcttttgat
ggggatgctgatagaatggttgctttaagtaaaactcatgtattttgtggggatgagctt
tgttatttgtttgctaaaaatatccctaatccacgcattttaggcgaggtaaaatgttct
aaaaatctttttgatgaagtggctaaatttggaactatttttatgggaaaaacaggacat
tctaatatcaaaaaaatgatgaaagaaaaagatattgatttagctgctgaggtgagtggg
catattttctttaaacatagatattttggttatgatgatggaatttatgcatttttaaga
gccttggagcttgtttataaaggttttgatctagaaagtatgattagagctttaccaaaa
ctttatactacacctgaaattaaaattcctgtaaatgaagaagaaaaattcaaacttgtg
gaagaatttcaaaaagagattgaaaaaggagctttaaaaggtgttaaaagtctttgtgaa
attgatggagctaggatagattttggcgatggatgggctttacttcgtgcatctaacacc
agcccttatcttatcacacgctttgaggcaacgtctttagaaagagcaaaagagcttgaa
agtatggtatttactttatttgatgatataaaagctagatttaagaattga

DBGET integrated database retrieval system