KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_1062Help
Entry
C8J_1062          CDS       T00597                                 

Gene name
wlaK
Definition
(GenBank) putative aminotransferase (DegT family)
  KO
K15910  UDP-N-acetylbacillosamine transaminase [EC:2.6.1.34]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
cju00520  Amino sugar and nucleotide sugar metabolism
cju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C8J_1062 (wlaK)
Enzymes [BR:cju01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.34  UDP-N-acetylbacillosamine transaminase
     C8J_1062 (wlaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABV52661
Structure
PDB: 

Position
complement(1070776..1071936)
Genome map
AA seq 386 aa AA seqDB search
MRFFLSPPHMGGNELKYIEEVFKSNYIAPLGEFVNRFEQSVKDYSKSENALALNSATAAL
HLALRVAGVKQDDIVLASSFTFIASVAPICYLKAKPVFIDCDETYNIDVDLLKLAIKECE
KKPKALILTHLYGNAAKMDEIVEICKENEIVLIEDAAEALGSFYKNKALGTFGEFGAYSY
NGNKIITTSGGGMLIGKNKEKIEKARFYSTQARENCLHYEHLDYGYNYRLSNVLGAIGVA
QMEVLEQRVLKKREIYEWYKEFLGEYFSFLDELENSRSNRWLSTALIDFDKNELNACQKD
INISQKNITLHPKISKLIEDLKNEQIETRPLWKAMHTQEVFKGTKAYLNGNSELFFQKGI
CLPSGTAMSKDDVYEISKLILKSIKA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagattttttctttctcctccgcatatgggcggtaatgaattaaaatatatagaagaa
gttttcaaaagcaattatatagcacctttgggtgaatttgtaaatcgctttgagcaaagt
gtaaaagattatagcaaaagtgaaaatgccttagctttaaattcagctacagcagctttg
catttagctttaagggtggcaggggtaaaacaagatgatattgttttggcttcttctttt
acttttatcgcttcagtggcgcctatttgttatcttaaagcaaaacctgtatttatagat
tgtgatgaaacttataatatcgatgtagatttgttaaaacttgctattaaggaatgtgaa
aaaaaaccaaaagcattgattttaactcatctttatggcaatgcggctaaaatggatgaa
attgttgaaatttgcaaggaaaatgaaattgttttaatcgaagatgctgctgaagcttta
ggaagtttttataagaataaagccttaggaacttttggagaatttggagcttattcttat
aatggcaataaaattatcaccacttcaggtggaggtatgcttataggaaaaaataaagaa
aagattgaaaaagcaagattttatagcactcaagctagggaaaattgtttgcattatgaa
catttagactatggttataattaccgtttaagcaatgttttaggagctattggtgtagca
caaatggaggttttagaacaaagagtgcttaaaaaaagagaaatttatgagtggtataaa
gaatttttaggagagtattttagctttttagatgaattagaaaattcaagaagtaatcgc
tggttaagtacagctttgattgattttgataaaaatgaacttaatgcttgtcaaaaagat
ataaatatcagtcaaaaaaatattactttgcatccaaaaatttcaaaactcatagaagat
ttgaaaaatgaacaaatagaaacaagaccattatggaaagctatgcacactcaagaagta
tttaaaggaactaaggcttatcttaatggcaatagtgagttatttttccaaaaaggaatt
tgtttgccaagtggtacggcgatgagcaaagatgatgtttatgaaatttcaaaactgatc
ttaaagagcataaaggcttaa

DBGET integrated database retrieval system