KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_1119Help
Entry
C8J_1119          CDS       T00597                                 

Gene name
argS
Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
cju00970  Aminoacyl-tRNA biosynthesis
Module
cju_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cju00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C8J_1119 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cju01007]
    C8J_1119 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cju03016]
    C8J_1119 (argS)
   03029 Mitochondrial biogenesis [BR:cju03029]
    C8J_1119 (argS)
Enzymes [BR:cju01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     C8J_1119 (argS)
Amino acid related enzymes [BR:cju01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   C8J_1119 (argS)
Transfer RNA biogenesis [BR:cju03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C8J_1119 (argS)
 Prokaryotic Type
   Other AARSs
    C8J_1119 (argS)
Mitochondrial biogenesis [BR:cju03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C8J_1119 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1 tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f Phage_sheath_1C tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ABV52718
UniProt: A8FMN1
Structure
PDB: 

Position
complement(1122878..1124470)
Genome map
AA seq 530 aa AA seqDB search
MKSIIFNEIKKILECDFTLENPKDKNLAHFATPLAFSLAKELKKSPMLIASDLASKFQNH
DCFESVEAVNGYLNFRISKTFLNELANQALANPNDFSKGEKKQESFLLEYVSANPTGPLH
IGHARGAVFGDTLTRLARHLGYKFDTEYYVNDAGNQIYLLGLSILLSVKENILHENVEYP
EQYYKGEYIADLAKEAFEKFGKEFFSEENIPSLADWAKDKMLILIKQNLEQAKIKIDSYV
SERSYYDALNATLESLKEHKGIYEQEGKIWLASSQKGDEKDRVIIREDGRGTYLAADIVY
HKDKMSRGYGKCINIWGADHHGYIPRMKAAMEFLGFDSNNLEIILAQMVSLLKDGEPYKM
SKRAGNFILMSDVIDEIGSDALRYIFLSKKCDTHLEFDISDLQKEDSSNPVYYINYAHAR
IHQVFAKAGKKIDDVMRADLQSLNQDGVNLLFEALNLKAILNDAFEARALQKIPDYLKNL
AANFHKFYNENKVVGSINENDLLKLFSLVALSIKTAFSLMGIEAKNKMEH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagtattatttttaatgaaattaaaaagattttagagtgtgattttacacttgaa
aatccaaaggataaaaatttagcacattttgctacccctttggctttttcactggctaag
gaattaaaaaaatctcctatgttgatcgctagcgacttagcgagcaaatttcaaaatcat
gattgttttgaatcggttgaagctgtaaatgggtatttaaattttagaatttccaaaact
tttttaaatgaacttgcaaatcaggctttagcaaatccaaatgatttttctaaaggagaa
aaaaaacaagaaagttttttgcttgaatatgtgagtgcaaatcctactggacctttacat
ataggacatgcaagaggcgctgtttttggagacaccttaacaagacttgcaagacatttg
ggttataaatttgatacagaatactatgtcaatgatgcgggtaatcaaatttatttacta
gggctttctattttactaagtgtgaaagaaaatatacttcatgaaaatgttgaatatcca
gagcaatattacaaaggcgagtatatagcagatttggcaaaagaagcttttgaaaaattt
ggtaaagaattttttagtgaagaaaatatccctagtttagctgattgggcaaaagataaa
atgcttattttgattaaacaaaatttagaacaagcaaagattaaaattgacagctatgta
agcgagagatcgtattatgacgctttaaatgcaactttagaatctttgaaagagcataaa
ggaatttacgagcaagaaggtaaaatttggcttgcttcttcgcaaaagggcgatgaaaaa
gatagggtaattatccgtgaagatggacgcgggacttatttggcagcagatattgtttat
cataaggataaaatgagtcgtggttatggaaagtgtattaatatctggggagcagatcat
catggttatatccctagaatgaaagctgcgatggagtttttgggatttgactctaataat
cttgagattattttagcacaaatggtttccttgcttaaagatggagagccttataaaatg
agtaaaagagcaggaaattttatcttgatgagcgatgtgattgatgaaataggaagtgat
gctttgcgttatatctttttgagtaaaaagtgcgatactcatttggaatttgatattagt
gatttgcaaaaagaagatagttctaatcctgtgtattatatcaactacgcacacgctaga
attcatcaagtgtttgctaaagctggtaaaaaaatcgatgatgtaatgagagctgattta
caaagtttaaatcaagatggtgttaatttactttttgaagctttgaatttaaaagctatt
ttaaacgatgcttttgaggctagagctttgcaaaaaattcctgattatcttaaaaatttg
gctgcaaattttcataaattctacaatgaaaataaagttgtaggttctataaatgaaaat
gatttgcttaaattattttctttagttgctcttagtattaaaaccgcattttctttaatg
ggtattgaagcgaaaaacaaaatggaacattaa

DBGET integrated database retrieval system