KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_1138Help
Entry
C8J_1138          CDS       T00597                                 

Definition
(GenBank) possible phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Brite
KEGG Orthology (KO) [BR:cju00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    C8J_1138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Flavi_NS4A
Motif
Other DBs
NCBI-ProteinID: ABV52737
Position
1143008..1144534
Genome map
AA seq 508 aa AA seqDB search
MQKDNLIAFVIFIISTIAFVIWGFGYISQHQLILFILASIFGIFMAFNIGGNDVANSFGT
SVGAKTVTIKQALIIAAVFELSGAIFAGAEVTKTIRSGIVIFPNSLDPMLFVIIMLAALL
SSGVWIFIATKKGLPVSTTHSIVGGIVGASIMMGLLKFDGIQTLSMVKWSEILRIAISWI
ASPLLGGIVAYIIYSYIDKKILKPSEKLNDDLKNIKKERKKFKEEYFLNLKTKSQEEQIK
ELSAIALDEEEQENNFYRNKMKEFKDQEKDIDIYSILKTHMPIIACIAAAIISAMFLFKG
LNNVSTLDILQNFWIIGIIGTISYVVTFAIVKIVKKTELNKTTDRIFSWFQIFTASSFAF
SHGANDIANAIGPFAAILDVLKNGTINATSPVPFAALAMFGVALVVGLWFLGKEVITTVG
SKLATIRPTTGFSAELGASIVILLATQFGIPVSSTHILIGAILGIGVYNKNANWIMMKPI
GLAWIITLPAAGIMAALVFLGFKLSLGI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagacaacctcatagcttttgttatttttattatcagtactatcgcatttgtt
atttggggatttggttatatttcgcaacatcaattgattctttttattcttgcttctata
tttggcatttttatggcatttaatataggtggaaatgatgtagccaattcttttggaaca
agcgttggcgcaaaaacagtaaccattaaacaagctttaattatagcagctgtttttgag
ctaagcggggcaatcttcgcaggcgcagaagttactaaaaccatacgcagcggtattgtt
atttttccaaattctttagatcctatgctttttgttatcattatgcttgctgcactttta
agctctggggtttggatttttattgcaaccaagaaaggcttacctgtatcaaccacacac
agtatagttggtggaattgtaggtgctagcattatgatggggcttttaaaatttgatggg
atccaaacactctctatggttaaatggagtgaaattttaagaatagctatttcttggata
gcttctcctcttttagggggtattgtagcttatattatttattcatatattgataagaaa
attttaaaaccatcagaaaaactaaatgatgatttgaaaaatatcaaaaaagaaagaaaa
aaattcaaagaagaatactttttaaatttaaaaacaaaatcccaagaagaacaaatcaaa
gaactttccgctatagctttagatgaggaagaacaagaaaataatttctatagaaataaa
atgaaggaatttaaggatcaagaaaaagatatagatatttactctattttaaaaactcat
atgccaatcattgcttgtattgctgctgctatcatttcggcaatgtttttatttaaaggt
ttaaataatgttagcactttagatattttacaaaacttttggattatcggaattatagga
actataagttatgttgtaacatttgctatagtcaaaatcgttaaaaaaacagaacttaat
aaaactactgatagaattttctcatggtttcaaatatttacagcctctagttttgcattt
tcacacggagccaatgatatagccaatgctataggtccttttgcagcgattttagatgtc
ttaaaaaacggcacaattaacgcgacttctcctgtaccttttgctgctttagctatgttt
ggagttgctctagttgtagggctttggtttttaggtaaagaagtgattactacagtgggt
tcaaaacttgcaaccatacgccctactactggattttctgcagaacttggtgcaagcata
gttatactcttagctacacaatttggaattcctgttagctccacccatatactcataggt
gctatattgggtataggagtgtataataaaaacgcaaattggattatgatgaagcctata
ggattggcttggattatcactttaccagccgctggtattatggcagcacttgtattttta
ggatttaaactatctttgggaatttaa

DBGET integrated database retrieval system