KEGG   Campylobacter jejuni subsp. jejuni 00-6200: PJ18_04050Help
Entry
PJ18_04050        CDS       T03792                                 

Definition
(GenBank) phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
cjw  Campylobacter jejuni subsp. jejuni 00-6200
Pathway
cjw00770  Pantothenate and CoA biosynthesis
cjw01100  Metabolic pathways
Module
cjw_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cjw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PJ18_04050
Enzymes [BR:cjw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     PJ18_04050
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     PJ18_04050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Fimbrial_CS1
Motif
Other DBs
NCBI-ProteinID: AJK72669
Position
771109..772263
Genome map
AA seq 384 aa AA seqDB search
MKTILLAISGSIAFYKSYELISLFKKEGFRVKVLLSNGLLKFASKMSFEALVDEVLCEEN
ESWQNSNNHIAFSKDVDLVLFTPASVNSINKLAFGIADNLFIQTLIAANKPLIIAPAANT
NMFHHFSTQNSLKILKENKALIIEPICKVLACKDEGVGALAEVKDIFNITKRELLKEKFW
CNKSVVITGGGTRERIDDVRCVSNFSSGKMAKAIADAFYFLGARVKLLSSVEFDTPYELC
KFESSKDLKELLDKNLSHDFLIMTAAVSDFIPQSVKGKIKKNEHLQGLNLHLSLNEDLLK
TCKFQGKKIGFKMEFDSQNALENAKKSLKDKQLDMVCLNIIDQKNYFGSDQNELYFITLN
NENKSTLQSKEKLAFELVKWCEKL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatacttttagccattagcggtagtatagctttttataaatcttatgagctt
atttctttgtttaaaaaagaaggctttagggtaaaagttttgctttctaatggtttgtta
aaatttgctagcaaaatgagttttgaagccttggttgatgaagttttatgtgaggaaaat
gaaagttggcaaaattcaaacaatcacatagcttttagcaaggatgtagaccttgttttg
tttacccctgcaagtgttaattctatcaataaacttgcttttggtatagcggataatctt
tttatccaaactttaattgcagcaaataaacctcttatcatagctcctgcggcaaataca
aatatgtttcatcattttagcacgcaaaattctttaaagatacttaaagaaaataaagct
ttgattatagagcctatttgtaaagttttagcttgtaaagatgaaggcgtaggagcctta
gctgaagttaaggatatttttaatatcaccaaaagagagcttttaaaagaaaagttttgg
tgcaataaaagcgtagttatcacaggtggcggcacaagggaaagaatcgatgatgtgcgt
tgtgtgagtaatttttcaagtggaaaaatggcaaaagccatagctgatgctttttatttt
ttaggagctagggtaaaacttttaagctctgtggaatttgatacgccttatgagctttgc
aaatttgaaagttctaaggatctaaaggagcttttggataaaaatttaagtcatgacttt
ttgattatgacggctgcagtgagtgattttatccctcaaagtgtaaaagggaaaattaaa
aaaaatgagcatttacagggtttaaatttgcatctatctttaaatgaagatttgcttaaa
acttgcaaatttcaaggcaaaaagataggttttaagatggaatttgattctcaaaatgcc
ttagaaaatgcgaaaaaatctctaaaagataaacaacttgatatggtttgccttaatatc
attgatcaaaaaaattattttggaagtgatcaaaatgaactttattttatcactttaaac
aatgaaaataaaagcactttgcaaagcaaagaaaaattggcatttgaattagtaaaatgg
tgtgaaaaattatga

DBGET integrated database retrieval system