KEGG   Campylobacter jejuni subsp. jejuni 00-6200: PJ18_04905Help
Entry
PJ18_04905        CDS       T03792                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
cjw  Campylobacter jejuni subsp. jejuni 00-6200
Pathway
cjw00860  Porphyrin and chlorophyll metabolism
cjw01100  Metabolic pathways
cjw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PJ18_04905
Enzymes [BR:cjw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     PJ18_04905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C Fer4_14
Motif
Other DBs
NCBI-ProteinID: AJK72823
UniProt: A0A0B6V4C2
Position
complement(923529..924884)
Genome map
AA seq 451 aa AA seqDB search
MRDYKAFVKYSKAGPRYTSYPTAVEFNANFKYEEYIEILKKQDRSLSLYFHLPFCRSACY
FCGCNVIYTAKEESKERYLTYIFKELDILSTILDTKREVVQMHFGGGTPTFFSAKQLQSL
ILKIRSVFGNFSKDAEISCEIDPRFLNEEQAIVLTQNGFNRISFGVQDFDEKVQKEIHRI
QSFELTQNALNLVRNKGIKSVNMDLIYGLPYQNLQSFTQTLEKVMLLNPDRLAIFNYAHV
PWLKKNMRKFDENTLPSPDVKLEILEFCEKFLSKNGYKMIGMDHFAKENDELFKALENGT
LHRNFQGYTTKGGADLVGVGLTSIGEGQRHYAQNFKDMSSYEAALDRGVLPFERGVILSD
DDELRKAVIMELMANFKLDIKSIEKEFSIDFKEYFKEDLKALEEYKDFVNFDENFIKVNE
TGVLLIRNIAMCFDAYMKNISEDKKVFSKTV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagagattataaagcttttgtaaaatactctaaagcaggaccacgctacacttcttat
cctacagcagtagagtttaatgcaaatttcaaatacgaagaatatatagaaattttaaaa
aaacaagatagatctttatcgctttattttcatttaccattttgtaggagtgcttgttat
ttttgtggttgcaatgtcatctatactgcaaaagaagagagtaaagaaaggtatttaact
tatatttttaaagagcttgatattttaagtaccattttagatactaaaagagaagtggtg
caaatgcactttggtggcggaactccaactttttttagcgctaaacaacttcaaagtttg
attttaaaaatcagatctgtttttggaaatttttctaaagatgcagagattagctgtgag
atcgatccgcgttttttaaatgaggaacaagccatagttttaacgcaaaatggctttaat
cgtattagctttggagtgcaggattttgatgaaaaagttcaaaaagaaattcatcgcatc
cagtcttttgaattaacacaaaatgctttaaatcttgtaagaaataaaggcataaagtct
gtaaatatggatttaatttatggtttgccttatcaaaatttacaaagctttacacaaact
ttagaaaaagttatgcttttaaaccctgatcgtttggcgatttttaattacgctcatgtg
ccttggcttaagaaaaatatgagaaaatttgatgaaaataccttgccaagtcctgatgtt
aagcttgaaattttagaattttgtgagaaatttttaagcaaaaatggttataaaatgata
ggaatggatcattttgcaaaagaaaatgatgagctttttaaagctttagaaaatggaact
ttacatagaaatttccaaggttataccaccaaaggcggtgctgatttagtcggtgttggg
cttacaagtataggcgaaggacaaagacattatgcacaaaattttaaagatatgtcaagt
tatgaagctgcattagatagaggagttttaccttttgaaagaggtgtgattttaagcgat
gatgatgagcttagaaaagcagtgattatggagttaatggcaaattttaagcttgatatt
aagtcaatagaaaaagaattttccattgattttaaggagtattttaaagaggatttaaaa
gctttagaagaatacaaagattttgttaattttgatgaaaattttatcaaagtcaatgaa
acaggtgttttgcttataagaaatattgctatgtgttttgatgcttatatgaaaaacatt
agtgaagataaaaaagtattctcaaaaacggtgtaa

DBGET integrated database retrieval system