KEGG   Campylobacter jejuni subsp. jejuni 00-6200: PJ18_05560Help
Entry
PJ18_05560        CDS       T03792                                 

Definition
(GenBank) aminotransferase DegT
  KO
K15910  UDP-N-acetylbacillosamine transaminase [EC:2.6.1.34]
Organism
cjw  Campylobacter jejuni subsp. jejuni 00-6200
Pathway
cjw00520  Amino sugar and nucleotide sugar metabolism
cjw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PJ18_05560
Enzymes [BR:cjw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.34  UDP-N-acetylbacillosamine transaminase
     PJ18_05560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AJK72951
UniProt: A0A0B6UZF8
Structure
PDB: 

Position
complement(1055904..1057064)
Genome map
AA seq 386 aa AA seqDB search
MRFFLSPPHMGGNELKYIEEVFKSNYIAPLGEFVNRFEQSVKAYSKSENALALNSATAAL
HLALRVAGVKQDDIVLASSFTFIASVAPICYLKAKPVFIDCDETYNIDVDLLKLAIKECE
KKPKALILTHLYGNAAKMDEIVEICKENEIVLIEDAAEALGSFYKNKALGTFGEFGAYSY
NGNKIITTSGGGMLIGKNKEKIEKARFYSTQARENCLHYEHLDYGYNYRLSNVLGAIGVA
QMEVLEQRVLKKREIYEWYKEFLGECFSFLDELENSRSNRWLSTALIDFDKNELNSCQKD
INISQKNITLHPKISKLIEDLKNEQIETRPLWKAMHAQEVFKGAKAYLNGNSELFFQKGI
CLPSGTAMSKDDVYEISKLILKSIKA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagattttttctttctcctccgcatatgggtggtaatgaattaaaatacatagaagaa
gttttcaaaagcaattatatagcacctttgggtgaatttgtaaatcgctttgaacaaagt
gtcaaggcttacagtaaaagtgaaaatgccttagctttaaattcagccacagcggctttg
catttagctttaagggtggcaggggtaaaacaagatgatattgttttggcttcttctttt
acttttatcgcttcagtagcacctatttgttatcttaaagcaaaacctgtatttatagat
tgtgatgaaacttataatatcgatgtagatttattaaagcttgctattaaagaatgtgaa
aaaaaaccaaaagcattgattttaactcatctttatggcaatgcggctaaaatggatgaa
attgttgaaatttgcaaagaaaatgaaattgttttaatcgaagatgctgctgaagcttta
ggaagtttttataagaataaagctttaggaacttttggagaatttggagcttattcttat
aatggcaataaaattatcaccacttcaggtggaggtatgcttataggaaaaaataaagaa
aagattgaaaaagcaagattttatagcactcaagctagggaaaattgtttgcattatgaa
catttagattatggttataattaccgcttaagcaatgttttaggagctattggcgtagcg
caaatggaggttttagaacaaagagtgcttaaaaaaagagaaatttatgagtggtataaa
gaatttttaggagagtgttttagctttttagatgaattagaaaattcaagaagcaatcgc
tggttaagtacagctttgattgattttgataaaaatgaacttaattcttgtcaaaaagat
ataaatatcagtcaaaaaaatattactttgcatccaaaaatttcaaaactcatagaagat
ttgaaaaatgaacaaatagaaacaagaccattatggaaagctatgcacgctcaagaagta
tttaaaggagctaaggcttatcttaatggcaatagtgagttatttttccaaaaaggaatt
tgtttgccaagtggcacggcgatgagtaaagatgatgtttatgaaatttcaaaactgatc
ttaaagagcataaaggcttaa

DBGET integrated database retrieval system