KEGG   Campylobacter jejuni 4031: BN867_08350Help
Entry
BN867_08350       CDS       T02864                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cjx  Campylobacter jejuni 4031
Pathway
cjx00450  Selenocompound metabolism
cjx00970  Aminoacyl-tRNA biosynthesis
cjx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BN867_08350
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN867_08350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cjx01007]
    BN867_08350
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cjx03016]
    BN867_08350
Enzymes [BR:cjx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BN867_08350
Amino acid related enzymes [BR:cjx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BN867_08350
Transfer RNA biogenesis [BR:cjx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BN867_08350
 Prokaryotic type
   Other AARSs
    BN867_08350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: CDH62675
Position
complement(811018..812904)
Genome map
AA seq 628 aa AA seqDB search
MRYITTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRFLTGTDEHGQKIEEAAKLR
NSTPQEYADKISFEFKKLWDEFEITYDIYARTTDTRHIEFVKAMFLKMWQKGDIYKDEYE
GHYCISCESFFTQSQLINDCSCPDCGKNTTILKEESYFFKLSKYQDKILQWYEEKDPILP
KNKKNELINFVQSGLKDLSITRTSFDWGIKLPQEINDDKHIIYVWLDALFIYISSLDFQS
KGENAKFWPAHVHLVGKDILRFHAIYWPAFLMSVDLPLPKFIGAHGWWTKEGEKMSKSKG
NVVKPKEVVDAYGSEAFRYFLLREVPFGNDGDFSENMLINRINAELSNEFGNLLNRIIGM
STKYSQGNILKEGVLKYYNTELNQAKEHLNLAVEFLENLQCNRYLEELFKALSVANLAIS
KYEPWNLIKENKHEQANALVALCANILAKTSLLLSPTLPKSCEKVALALNFEISSTNYAK
MILDNELLDFKANPCEALFPKVEKALLKQEIKEEPKKEESPKIKIDDFAKIEIKVAKVLD
CQNIEGSEKLLKFQLELDDKEIRQVLSGIAKHYKASDLIGKQVCIISNLKKAKIFGHESD
GMILSAKSGDKLVLITPEQLVQNGSLVG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatattacaacaccaatttattatgtaaatgatgtgcctcatttaggtcatgct
tatactaccatcatagccgatactttagcaagattttatcgtttgcaaggacatgaaaca
agatttctaacaggaacagatgagcatggacaaaaaatcgaagaagctgccaaactaaga
aattccactcctcaagaatatgctgataaaatcagttttgaatttaaaaaattatgggat
gaatttgaaatcacctatgatatttacgcaagaacaactgatacaaggcatattgaattt
gttaaagctatgtttttaaaaatgtggcaaaaaggcgatatttataaagatgaatacgaa
ggacactattgtatttcttgcgaaagcttttttactcaaagtcagcttatcaatgattgt
tcttgtccagattgtggcaaaaacactacgattttaaaagaagagagttatttttttaaa
ctttcaaaataccaagataaaattttacaatggtatgaagaaaaagatcccatcctacca
aaaaacaaaaaaaacgaacttataaattttgtccaaagcggccttaaagatctttccatt
acaagaacaagttttgattgggggattaaactgcctcaagaaattaatgatgataaacat
attatttatgtatggcttgacgcactttttatctatataagctctcttgattttcaaagc
aagggagaaaatgctaaattttggcctgcgcatgtgcatttagtaggaaaagatattttg
cgttttcatgccatttattggccagcttttttaatgagcgtagatttacctttgccaaaa
tttataggtgcacatggctggtggactaaagaaggtgaaaaaatgagcaaatctaaaggc
aatgttgtaaaacctaaagaagtggttgatgcctatggaagcgaagcttttagatatttc
ttgcttagagaagtgccttttggtaatgatggggattttagcgaaaatatgctgataaat
cgtatcaatgctgaactaagcaatgaatttgggaatttgcttaatcgcattataggtatg
agtacaaaatattctcaaggaaatattttaaaagaaggtgttttaaaatattacaatact
gaactaaatcaagcaaaagaacacttaaatttagcggtagaatttttagaaaacttacag
tgtaatcgttatttagaagaactttttaaagccttaagcgtagcaaatttagccatcagc
aaatacgaaccttggaatttaatcaaagaaaacaaacacgaacaagctaacgctttagtt
gcactttgtgcaaatattttagccaaaacaagccttttattaagccctactctaccaaag
tcctgtgaaaaagtggctttagctttaaattttgaaatttcatctacaaattacgcaaaa
atgatacttgataatgaacttttagattttaaagcaaatccttgcgaagctttatttcca
aaagtagaaaaagctcttttaaaacaagaaattaaagaagaacctaaaaaagaagaaagt
cctaaaataaaaatcgatgattttgcaaaaattgaaatcaaagtcgctaaggtgcttgat
tgtcaaaatatagaagggagtgaaaaacttttgaaatttcaactcgaacttgacgataaa
gaaatccgtcaagtactctcaggcatagcaaaacactataaagccagtgatttaatcggt
aaacaagtttgcattataagcaatcttaaaaaagctaaaatttttggacatgaaagcgat
ggtatgatactttctgcaaaaagcggagataaacttgttttaatcacccctgaacaactt
gtacaaaacggttctttagtaggctaa

DBGET integrated database retrieval system