KEGG   Campylobacter jejuni 32488: M635_07840Help
Entry
M635_07840        CDS       T02759                                 

Definition
(GenBank) N5-carboxyaminoimidazole ribonucleotide mutase
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
cjz  Campylobacter jejuni 32488
Pathway
cjz00230  Purine metabolism
cjz01100  Metabolic pathways
cjz01110  Biosynthesis of secondary metabolites
cjz01130  Biosynthesis of antibiotics
Module
cjz_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cjz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    M635_07840
Enzymes [BR:cjz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     M635_07840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC PrpR_N DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AGQ95368
Position
1508336..1508830
Genome map
AA seq 164 aa AA seqDB search
MNFVSILMGSKSDYETMKEAAKTLESFGVKYELIISSAHRSPKRTKEYIANAEKKGVKVF
IAAAGMAAHLAGAVAAYTTKPVLGVPMSGSNLASMDSLFSTVQMPSGIPVGTLAIGKAGA
INAAYLAMQILAIYDVDLAQKLKEDRLEKEKKLVSDSKEVEVLL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgtttctattttaatgggaagcaagagtgattatgagactatgaaagaggct
gctaaaactttagaaagttttggggtaaagtatgaacttattatctcatcagctcatcgt
agtccaaaaagaacaaaagagtatattgcaaatgctgaaaaaaaaggtgtgaaagttttt
atagcagcagctggaatggcagcgcatttagctggagctgttgcagcttatacaacaaaa
cctgttttgggagtgcctatgtcaggaagcaatcttgcaagtatggattctttgttttct
acggtgcaaatgcctagtggaattcctgtaggaactttagctattggtaaggctggagca
atcaatgctgcttatttggctatgcaaattttagctatttatgatgttgatttagcacaa
aagcttaaagaagatcgtcttgaaaaagaaaaaaaacttgtatctgattcaaaagaagta
gaagttttattataa

DBGET integrated database retrieval system