KEGG   Comamonas kerstersii: B5M06_03085Help
Entry
B5M06_03085       CDS       T04758                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cke  Comamonas kerstersii
Pathway
cke00071  Fatty acid degradation
cke00072  Synthesis and degradation of ketone bodies
cke00280  Valine, leucine and isoleucine degradation
cke00310  Lysine degradation
cke00362  Benzoate degradation
cke00380  Tryptophan metabolism
cke00620  Pyruvate metabolism
cke00630  Glyoxylate and dicarboxylate metabolism
cke00640  Propanoate metabolism
cke00650  Butanoate metabolism
cke00900  Terpenoid backbone biosynthesis
cke01100  Metabolic pathways
cke01110  Biosynthesis of secondary metabolites
cke01120  Microbial metabolism in diverse environments
cke01130  Biosynthesis of antibiotics
cke01200  Carbon metabolism
cke01212  Fatty acid metabolism
cke02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cke00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B5M06_03085
   00630 Glyoxylate and dicarboxylate metabolism
    B5M06_03085
   00640 Propanoate metabolism
    B5M06_03085
   00650 Butanoate metabolism
    B5M06_03085
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B5M06_03085
   00072 Synthesis and degradation of ketone bodies
    B5M06_03085
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B5M06_03085
   00310 Lysine degradation
    B5M06_03085
   00380 Tryptophan metabolism
    B5M06_03085
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B5M06_03085
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B5M06_03085
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B5M06_03085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cke04147]
    B5M06_03085
Enzymes [BR:cke01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B5M06_03085
Exosome [BR:cke04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B5M06_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQZ97396
UniProt: A0A1V0BBS8
Position
complement(654633..655829)
Genome map
AA seq 398 aa AA seqDB search
MREAVIVSTARTPLTKSHRGEFNITPAAQLAAFSVKAAVERSGVDPEMIEDLILGCGNPD
GFQGRNLGRQTVIRAELPLSIAGTTITRYCASGLQSMAIAAGRVVAEGVDAMIAGGVESI
SGIRPGNNLPTDMDPWLVEHKPELFMAMIDTADVVAKRYNISREDQDAFSLLSQQRTAAA
QAAGLFDNEIIACATKMAEKNKETGEVTYRDVVATKDNCNRASTTLEGLAKLEPVKGPGN
FITAGNASQLSDGSSACVVVEAKVAERLGLKPLGAFRGFAVAGCEPDEMGIGPVFAVPKL
LARHGLTVDDIDLWELNEAFASQALYCQRQLGIPMERLNVNGGAISIGHPFGMTGARLAG
HILLEGQRRKAQGQKVKYGVVTMCIAGGMGAAGLFEIF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagccgtcattgtttccaccgcacgcacaccgctgaccaagtcgcaccgtggc
gagttcaacatcacgccagccgcacagctggccgcgttttccgtcaaggcggccgtggag
cgctcgggtgtagaccccgagatgatcgaggacctgatcctcggctgcggcaaccccgat
ggctttcagggccgcaacctgggccgccagaccgtcatccgtgccgagttgccgctgagc
attgcgggcaccaccatcacgcgctactgcgcttcggggctgcagtcgatggcgattgct
gcaggccgcgtggtggctgaaggggtggacgccatgattgccggtggtgtggaaagcatt
tccggcatccgccctggcaacaatttgcccaccgacatggacccctggctggtcgagcac
aagcccgagctgttcatggccatgattgacaccgccgatgtggtggccaagcgctacaac
atctcgcgtgaagaccaggatgctttctcgctgctgagccagcagcgcaccgccgcagca
caggctgccggtctgtttgataacgaaatcattgcctgcgccaccaagatggcggagaag
aacaaggaaaccggcgaagtcacctaccgtgacgttgtcgccaccaaggacaactgcaac
cgcgccagcaccacgctggaaggcctggccaagctcgaacccgtgaagggccccggcaac
ttcatcaccgccggtaatgcctcgcagctgtccgatggctccagcgcctgcgtggtggtg
gaggccaaggtggctgagcgtctgggcctgaagcccctgggcgccttccgtggctttgcc
gtcgctggttgcgagcctgacgaaatgggcatcggccccgtgtttgccgtgcccaagctg
ctggcgcgccacggcctcacggtggatgacatcgatctgtgggagctgaacgaagccttt
gcttcccaggcgctgtactgccagcgccagctgggcatccccatggaacgcctgaacgtc
aacggcggcgcgatctccatcggccacccctttggcatgacgggcgcacgtctggccggt
cacatcctgctcgaaggccagcgccgcaaggcccagggccagaaggtgaagtacggcgtc
gtcaccatgtgcatcgccggtggcatgggcgcagcaggcctgtttgaaattttctga

DBGET integrated database retrieval system