KEGG   Comamonas kerstersii: B5M06_09620Help
Entry
B5M06_09620       CDS       T04758                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cke  Comamonas kerstersii
Pathway
cke00790  Folate biosynthesis
cke01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cke00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B5M06_09620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cke04147]
    B5M06_09620
Enzymes [BR:cke01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     B5M06_09620
Exosome [BR:cke04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B5M06_09620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a Imm50 MRPL52
Motif
Other DBs
NCBI-ProteinID: AQZ98468
UniProt: A0A1V0BES5
Position
2057030..2057338
Genome map
AA seq 102 aa AA seqDB search
MKLDQNLRAKLLPDLPDWTFKDERGGLIARDFVFHDFAQAFAFMAQVALYAEKHNHHPEW
FNVYNRVSVTLTTHDVEGLSIQDIQMAQHMDRIAQALQQQTL
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggatcaaaacctgcgcgcaaagctgctgcccgacctgccggactggacgttc
aaggacgagcgcggcggtctgatcgcgcgcgactttgtgtttcatgactttgcccaggcc
ttcgctttcatggcccaggttgccctgtatgcggaaaagcacaaccaccatccggagtgg
ttcaacgtctacaaccgggtgtcggtcacgctgactacgcatgacgtagaggggctgtcc
attcaggacatccagatggcgcagcacatggaccgcatcgcgcaggccctgcagcagcag
acgctgtga

DBGET integrated database retrieval system