KEGG   Comamonas kerstersii: B5M06_11900Help
Entry
B5M06_11900       CDS       T04758                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cke  Comamonas kerstersii
Pathway
cke00564  Glycerophospholipid metabolism
cke01100  Metabolic pathways
cke01110  Biosynthesis of secondary metabolites
Module
cke_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cke00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B5M06_11900
Enzymes [BR:cke01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     B5M06_11900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Ytca
Motif
Other DBs
NCBI-ProteinID: AQZ99946
UniProt: A0A0W7Z1T9
Position
complement(2539070..2539918)
Genome map
AA seq 282 aa AA seqDB search
MSDRLAVLPQYLLPKRALTQLMGYLASREAGAVTTAVIRWFIRRYQVNMAEALNPDPAAY
SSFNSFFTRELKPGVRPLADSEWICPVDGAVSQLGRIQGDQIFQAKGHSYSTQALVGGDA
QLAAQFQDGHFATIYLSPRDYHRIHMPCAGRLLRMIHVPGDLFSVNPTTARGVPGLFARN
ERVVCVFEGKHGPFVMVLVGATIVGSMATTWHGVVNPPRPGHVREWNYADKNIHLEQGAE
MGRFLLGSTVVLLTPPGPLQFNADWCATAPVRLGEAMASQQP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgatcgcctcgcggttcttccgcaataccttcttcccaagcgcgcactgacgcag
ctcatgggctatcttgccagccgagaagctggtgcagtgactaccgcagtcattcgctgg
ttcatccgtcgctaccaggtcaacatggccgaagccctcaacccggacccagctgcctat
tccagcttcaacagctttttcacgcgagaactcaagccaggcgtacgcccactggccgac
tcagaatggatctgccccgtagatggtgcagtcagtcagctcggacgcattcagggcgat
cagatttttcaggccaaaggacactcttactccacgcaggcactggtgggtggcgatgcg
cagctggcagcacagtttcaggatggtcacttcgccaccatctaccttagccctcgcgac
taccaccgcatccacatgccctgcgcaggccgtctgctgcgcatgattcatgtcccgggc
gacctgttttcagtgaaccccaccaccgcccgaggcgtacccggtctgtttgcacgcaac
gagcgtgtggtgtgcgtgtttgaaggcaagcatggtcccttcgtcatggtgctggtaggt
gccaccatcgtcggcagcatggccaccacctggcatggtgtagtgaacccgccccgccct
ggacacgtgcgtgaatggaactacgcggataaaaacatacacctggagcaaggtgctgaa
atgggacgtttcctgctcggctccacggtcgtcctgctcacaccgccaggcccgctgcaa
ttcaatgcagactggtgcgcgacagcacccgtacgcctgggcgaggcgatggccagtcag
cagccgtaa

DBGET integrated database retrieval system