KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1024Help
Entry
Calkr_1024        CDS       T01356                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00230  Purine metabolism
cki01100  Metabolic pathways
Module
cki_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Calkr_1024
Enzymes [BR:cki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Calkr_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 AAA_16 AAA_28 AAA_30 cobW T2SSE
Motif
Other DBs
NCBI-ProteinID: ADQ40532
UniProt: E4S5K8
Position
1086833..1087432
Genome map
AA seq 199 aa AA seqDB search
MREGLLIVISGPAGTGKGTVVGKLLEKNPNIKLSISKTTRKPRPGEKEGVNYFFVSREQF
EEEIKNERFLEYAEYNNNYYGTPKDFVFEALEKGFDVILEIETQGALKIKKAFSDAVLIF
LLPPSIEELYRRLVKRGTESEDEIKARLEIAKNEIKLVPEYDYCVINDNVDDAAEKIQKI
IEVEKLKSRRFDIQSFLKE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagagagggacttttgattgtaatatcagggcctgcagggactggaaagggtacagtt
gttggaaagcttcttgagaaaaatccaaatattaagctttcaatctccaagaccacgaga
aagccgaggccaggggaaaaagagggtgtgaactatttttttgtatcgcgcgagcaattt
gaagaagagattaaaaatgaaagatttttagaatatgctgagtataacaataactattat
ggtacgcccaaggattttgtctttgaggcattggaaaagggctttgatgtaattttggag
attgaaacacagggagcgctcaagattaaaaaagccttttcggatgcagtactaatattc
ttattgccaccatccatagaagagctttatagaagacttgtaaaaagaggcaccgagtct
gaagatgaaatcaaggcaagacttgagattgccaagaacgagataaaacttgtgccagag
tatgactattgtgttataaatgacaatgtggatgatgctgctgaaaagatacaaaagatt
attgaagttgaaaaactaaagagtagacgatttgatatacaaagttttttgaaggagtga

DBGET integrated database retrieval system