KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1134Help
Entry
Calkr_1134        CDS       T01356                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00040  Pentose and glucuronate interconversions
cki00052  Galactose metabolism
cki00500  Starch and sucrose metabolism
cki00520  Amino sugar and nucleotide sugar metabolism
cki01100  Metabolic pathways
cki01130  Biosynthesis of antibiotics
Module
cki_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Calkr_1134
   00052 Galactose metabolism
    Calkr_1134
   00500 Starch and sucrose metabolism
    Calkr_1134
   00520 Amino sugar and nucleotide sugar metabolism
    Calkr_1134
Enzymes [BR:cki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Calkr_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: ADQ40642
UniProt: E4S6M7
Position
1190794..1191702
Genome map
AA seq 302 aa AA seqDB search
MRRLIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEALESGIESILIVTGR
GKRAIEDHFDKSFELEVALENKKDYDNLQLIRKIADYNVHYIRQKEPRGLGDAVYCARLF
IDNEPFAVLLGDDIIISEKPCLKQLIEVYEEYRTTILGVQKVPEDDVSKYGIVAGKQIEE
RIYKVKDLIEKPKKEEAPSNIAVLGRYIITPEILNILQNTKEGVGGEIQLTDALRELSKK
EAMYAYEFEGKRYDVGNKLGFLQATVEIALSREDIGKDFYNYLVTLVNAKNYKEKLNELD
KI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaggcttatcaaaaaagcaatcattcctgcggcaggacttggaacaaggtttttg
ccggcaacaaaagcacagcccaaagagatgcttcctattgtggacaagccaacaattcaa
tacatagttgaagaggcgttagaatcggggatagagagcattttgattgtcacagggcgt
ggcaaaagagcaattgaggaccattttgacaagtcttttgagcttgaggttgcgctcgaa
aacaaaaaggattatgacaatcttcaattgataagaaagatagcagattacaatgttcat
tacatacgacaaaaagaaccaagagggcttggagatgcagtatattgtgcaagacttttt
atcgacaatgaacctttcgcagttttgcttggagatgacatcatcatttctgaaaagcca
tgtttaaaacagctgatagaggtgtatgaagagtacaggacaaccatcttgggtgtgcaa
aaagtaccagaggatgatgttagcaagtacggaattgttgcaggaaaacagatagaagag
agaatttacaaggtaaaagacctcattgaaaagccaaaaaaggaagaagcaccttcgaat
attgctgtgcttggaagatatatcataactccggagatattaaatattctacaaaataca
aaagaaggcgttggtggcgagattcaattgactgatgctttaagagagttatcaaaaaaa
gaagctatgtatgcttatgagtttgaagggaaaagatatgatgttggcaataaacttgga
tttttgcaggcaacagtcgaaattgctctttcaagggaagacattggcaaagatttttac
aactatcttgtcactcttgtaaatgctaagaattataaagaaaagttgaatgagttagat
aagatttaa

DBGET integrated database retrieval system