KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1279Help
Entry
Calkr_1279        CDS       T01356                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
cki  Caldicellulosiruptor kristjanssonii
Brite
KEGG Orthology (KO) [BR:cki00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Calkr_1279
Enzymes [BR:cki01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Calkr_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP PHP_C
Motif
Other DBs
NCBI-ProteinID: ADQ40786
UniProt: E4S7P6
Position
1336234..1336935
Genome map
AA seq 233 aa AA seqDB search
MKLYYDLHIHSLLSPCADNDMTPHNIINMAKIKGLDVISVTDHNSTLNLESFLEVANLLD
ILFIPGVEIETEEEIHVLLYFKHKDVSIIREFQSIIDKHLPFVKLREDIYGNQYTVDTQD
NIIGSYEKLLLQPLTLNLKQIYEVSKFYNMIFVPAHINRQSFGVIGRLGFLPEELTDLTF
LEVSKTTEIEFAKFLPQNRDYIFLHSSDAHHLWEINEREFFIESDILYTIFFD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaagctatattatgaccttcatattcattcgttgctttctccgtgtgcagacaatgat
atgacgccacataatataataaatatggctaagataaagggcttagatgttatttcagta
acagaccataactctaccttaaaccttgaaagttttttagaagtggcaaacttgcttgat
atcttgtttatacctggggttgagattgaaacagaagaggagattcatgttctgctgtat
tttaagcacaaagatgtttcgattataagagaatttcagagcattattgacaaacatttg
ccttttgtaaagctcagagaagacatttatggtaatcaatacactgttgatacacaggac
aatataatcggaagctatgaaaaacttcttcttcaaccacttactctaaacttaaaacag
atttatgaggtttctaaattctacaatatgatttttgtccctgcccacataaacagacag
tcttttggcgtaattggaaggcttggctttttgcccgaagagctaactgatttgaccttt
ttagaggtatcaaagaccactgaaatagaatttgccaagtttcttcctcaaaacagagat
tatatttttctccactcctcagatgctcatcatttgtgggagataaacgaaagagaattt
tttattgaaagtgatatactgtatacaatatttttcgattaa

DBGET integrated database retrieval system