KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1391Help
Entry
Calkr_1391        CDS       T01356                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00010  Glycolysis / Gluconeogenesis
cki00051  Fructose and mannose metabolism
cki01100  Metabolic pathways
cki01110  Biosynthesis of secondary metabolites
cki01120  Microbial metabolism in diverse environments
cki01130  Biosynthesis of antibiotics
cki01200  Carbon metabolism
cki01230  Biosynthesis of amino acids
Module
cki_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cki_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkr_1391
   00051 Fructose and mannose metabolism
    Calkr_1391
   00562 Inositol phosphate metabolism
    Calkr_1391
Enzymes [BR:cki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Calkr_1391
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Calkr_1391
Exosome [BR:cki04147]
 Exosomal proteins
  Proteins found in most exosomes
   Calkr_1391
  Exosomal proteins of colorectal cancer cells
   Calkr_1391
  Exosomal proteins of bladder cancer cells
   Calkr_1391
  Exosomal proteins of melanoma cells
   Calkr_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK TIM SIS_2 DREPP
Motif
Other DBs
NCBI-ProteinID: ADQ40893
UniProt: E4S8C0
Position
complement(1442789..1444741)
Genome map
AA seq 650 aa AA seqDB search
MPKLNKKTIRDIDVAGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVIL
VSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGEDAKKCVEQMKEGDVVLLEN
VRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIE
MLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKS
KCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIG
NTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDS
AAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACLLDKNPRKKIIAANWKMNKTPQE
AKEFVEELKKYIDDVQAEVVICAPSILVPYVKEVIEGTNIKLGTQNMFYEEKGAYTGEIS
GPMLKEVGVEYVVIGHSERRQYFGETDEIVNKKVLAALKFGIKPIVCVGETLKQREYGIT
DELVRLQVKIALNGVPKEDVEKVVIAYEPIWAIGTGKNATPEEANRVIGVIRNVIAEMYD
EDTAQKVRIQYGGSVNSANSADIFNMPEIDGGLVGGASLNAQEFAKILHY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagctcaacaaaaagaccataagagatatagatgttgctggtaagagagttctt
gtgagggttgattttaacgttccacaagatgaaaatggtaatatcactgacgatagaaga
ataagagaagctcttcctacaataaagtatctaattgaccacaacgcaaaggtaatattg
gtatcccatttaggaagaccgaagggcaaatttgacccgaaatactcaatggcccctgtt
gcaaaaagactttctgagcttcttggcaaagaagttgttcttgcaaaagacgttataggc
gaggatgcgaaaaagtgtgttgagcagatgaaagaaggagatgtagttcttcttgaaaat
gtgagattccacaaagaggaagaagaaaacgacagagaatttgcaaaagctttagcatcg
cttgcagacatttatgtcaatgacgcgtttggtacagctcacagagcacatgcatcaaca
gcaggtgttgcagagttcttgcctgcagttgctggatttttgatggaaaaagaaatagag
atgcttggcaatgctcttgcaaatccgcaaagaccttttgttgcaatcttgggtggcgca
aaagtttctgacaagattggggttattacaaatcttcttgagaaggttgatagtctctta
attggcggtgcaatggcttataccttcttgaaagcaaaaggatataaaatcgggaagtca
aaatgcgaagatgataagcttgatgttgcaagagagataatgaaaaaggcagaggaaaaa
ggagtaaaccttttgctgcctgttggaagcatagtagcaaaagagtttaaaaatgataca
gagtttatgtacgtaccatcagatgcaatgccagacgatatgatgggtatggatatagga
aataccacaattgagcttttctcaaaagagataaagaaggcaaagacaattgtttggaac
ggaccaatgggcgtatttgaatttccaaactttgcaaagggaacagaagctattgcaaga
gctgttgctgaggctgttgaagaaaatggcgcaattgcaattatcggtggtggcgactct
gcagctgctgttgaaaaactggggtttgctgataagatgacacatatttcaacaggtggc
ggtgcttcattagagttcttggaaggcaaagttttaccaggtattgcatgtcttcttgat
aaaaacccaagaaaaaagataatcgcagcaaactggaagatgaacaagactccacaagaa
gcaaaagagtttgttgaagagttaaagaagtatatcgacgatgttcaggcagaagtagtt
atctgtgctccatcaattcttgttccttatgtcaaagaagtaatagaaggaacgaatata
aaactcggaacacaaaacatgttctatgaagaaaaaggtgcatatacaggtgagatctcc
ggtccaatgttaaaggaagttggagttgagtatgtggtaattggtcactctgaaagaaga
cagtattttggtgaaactgatgagattgtgaacaagaaagtgttagcagcgctcaagttt
ggtatcaagcctattgtatgtgttggtgagacattaaagcaaagagaatacggcattaca
gatgagcttgtaaggcttcaggtcaagattgcgctaaatggtgttccaaaagaagatgtc
gaaaaggttgtcattgcgtatgagcctatctgggcaataggtacaggtaagaatgcaaca
cctgaagaggcaaatagagtaattggggttatcagaaatgtaattgcagagatgtacgat
gaagatactgcgcaaaaggttagaatccagtacggtggtagtgtaaactctgcaaattca
gcagacattttcaatatgccagagattgatggaggtttagttggcggtgcaagccttaat
gctcaggaatttgcaaagatattacactactaa

DBGET integrated database retrieval system