KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1470Help
Entry
Calkr_1470        CDS       T01356                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cki  Caldicellulosiruptor kristjanssonii
Brite
KEGG Orthology (KO) [BR:cki00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Calkr_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADQ40972
UniProt: E4S9A3
Position
1521465..1522463
Genome map
AA seq 332 aa AA seqDB search
MHNIPLNLLLIIILALTFDFINGFHDTANAIATSVSTRVLAPRTAIFMSAVFNFFGAMIN
TEVAKTIGHGIVDPRFVTQNLVLAAVIAAIVWDLITWWWGIPSSSSHAIIGGLVGAAIAA
TKSLADINWIGFVKKIVLPLIVSPILGFVFGYLFMMILYIVFAKVHPTIINRYFSKLQIL
SAMWMAYSHGSNDAQKSMGIITMALVGSGILNEFVVPDWVKFACALAMALGTSVGGWRII
KTMGIKIIKLAPINGFAAETGAALTIQFATHIGAPVSTTHVISSSIMGVGACKKFSAVRW
GVARNIVIAWVLTIPMCAILGAIISILINWIA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcataacataccacttaatttacttttaataatcattttagccctgacttttgatttt
ataaacggttttcatgacacagcaaatgctattgcaacatcagtttcaacaagagtgtta
gcaccgcgcactgccatatttatgtcagcagtatttaacttctttggtgcgatgataaac
acagaggttgcaaagacaattggccatggaatagttgacccgagatttgttacacaaaac
cttgtgcttgcggctgtaattgcagcaattgtgtgggacttgattacatggtggtgggga
ataccttcttcctcgtcacatgcaataattggtggtcttgtgggtgctgcaattgccgcc
acaaaatcacttgccgatataaattggatagggtttgtcaaaaagattgttcttcctttg
attgtctcccctatcttaggttttgtatttggatatctatttatgatgattctttacata
gtgtttgctaaagtacatccaactataattaatagatatttctcaaagctccaaatactc
tctgcaatgtggatggcatatagtcatggttcaaacgacgctcaaaaatccatgggaata
ataaccatggcgctggtaggaagtggaatcttaaatgagtttgttgtgcctgactgggta
aaatttgcctgtgctcttgccatggctttgggtacatcagtaggcggctggcgaataatt
aaaacaatgggaataaagataataaaacttgcaccaataaacggctttgcagcagaaacc
ggcgcagcactaacaatccagtttgcaactcatattggtgcaccagtttccaccactcat
gtcatctcgtcctctattatgggggtaggtgcatgtaaaaagttttcagctgttagatgg
ggggttgcaagaaatattgttattgcatgggttttgacaatcccaatgtgtgctattttg
ggagctatcatttctattttaatcaattggatagcatag

DBGET integrated database retrieval system