KEGG   Caldicellulosiruptor kristjanssonii: Calkr_2328Help
Entry
Calkr_2328        CDS       T01356                                 

Definition
(GenBank) Conserved carboxylase region
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00620  Pyruvate metabolism
cki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Calkr_2328
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cki02000]
    Calkr_2328
Enzymes [BR:cki01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Calkr_2328
Transporters [BR:cki02000]
 Other transporters
  Primary active transporters [TC:3]
   Calkr_2328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: ADQ41778
UniProt: E4S795
Position
complement(2392759..2394150)
Genome map
AA seq 463 aa AA seqDB search
MKRIFITETVLRDAQQSLIATRMPYEDFEGILEKIDKAGYYSIECWGGATFDSCLRYLNE
DPWERLRKIKSKVKNTKLQMLLRGQNLLGYRHYPDDVVRMFVRKSIENGMDIIRIFDALN
DLRNIEVAVDETIKAGGHAQGTIVYTISPIHSLEMYVKIGKELESMGVHSICIKDMAGIM
SPKEAYELVKALKENARVPVFLHTHSTTGLGILTYLKAVEAGVDGIDTAISSFSGGTSQP
PTETLNYALKQMGYDTNLNDKLLKEINDFFKPVKDKFINNGILNPFVLSTDTDALIYQIP
GGMLSNLIAQLKQQNALDKLESVLLEVPKVREDLGYPPLVTPMSQMVGTQAAANVLSGER
YKVILKEVKAYIRGEYGRPPGKINPELVKKVLGSEKPIEGRFADTLEPIFEKTKEQVKDF
AKSDEDVLSYILFPQVAEEFLKNRGKNKLPKERKIEYTIEGIS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaatcttcattacagaaaccgttttaagggatgctcagcagtctttaatcgca
acaaggatgccttatgaagattttgaaggaattttagagaaaatagataaggcggggtat
tattctattgaatgctggggcggtgcaacatttgattcgtgtctaagatacctaaatgaa
gatccgtgggagcgcttgagaaaaataaagtcaaaggtgaaaaacacaaagcttcagatg
cttcttcgcggtcaaaaccttttaggctacagacactacccagatgatgttgtgaggatg
tttgtccgaaaatctattgaaaatggcatggatataataagaatatttgatgctttaaac
gaccttcgaaacatcgaggttgcagttgatgagacaatcaaagcaggcggccatgcccag
ggaacaattgtgtataccataagcccaatccacagccttgagatgtacgtaaagattgga
aaggaacttgagagtatgggtgttcattctatctgcataaaagacatggcaggtatcatg
agccctaaagaggcgtacgagcttgtgaaggctttaaaagaaaatgcaagagtaccagtt
ttccttcacacccactcaacaacagggcttgggatattgacatacctcaaagcagtagaa
gctggtgttgatggaattgatacagcaatctcaagcttttcaggaggcacatcccagcca
ccaacagagacgctcaactatgcactaaagcaaatggggtatgatacaaatcttaatgat
aagcttttaaaagagataaacgactttttcaagcctgtaaaagacaagtttataaacaac
ggaattttaaatccttttgttctttcaacagacacagatgcgctaatttaccagattcca
ggaggtatgctttcaaacctcatagcccagctaaaacagcaaaatgcccttgacaagtta
gaaagtgttttgcttgaagttccaaaggtaagagaagacttaggttatccaccacttgtt
acacctatgagccagatggttggaacgcaggctgctgcaaacgtgctgtctggtgagaga
tacaaggtgatcctcaaagaagtaaaggcatatataagaggcgaatatggcagaccaccc
ggaaagatcaaccctgagcttgtcaaaaaagtgctcggtagcgaaaagccgattgaggga
aggtttgcagacactttagagcccattttcgaaaagacaaaggagcaagtcaaagatttt
gcaaaaagcgatgaagatgtgttgtcttacattctcttccctcaggttgctgaggaattt
ttgaaaaacagaggcaaaaacaaacttccaaaagagagaaagattgaatatacaatagaa
ggaatatcgtaa

DBGET integrated database retrieval system