KEGG   Clostridium kluyveri DSM 555: CKL_1107
Entry
CKL_1107          CDS       T00564                                 

Symbol
pfl
Name
(GenBank) Pfl
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ckl00620  Pyruvate metabolism
ckl00640  Propanoate metabolism
ckl00650  Butanoate metabolism
ckl01100  Metabolic pathways
ckl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ckl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKL_1107 (pfl)
   00640 Propanoate metabolism
    CKL_1107 (pfl)
   00650 Butanoate metabolism
    CKL_1107 (pfl)
Enzymes [BR:ckl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     CKL_1107 (pfl)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: EDK33149
UniProt: A5N768
Position
complement(1153809..1156043)
AA seq 744 aa
MKKKWKNFNTGNWTENIDVRNFIQKNYTPYTGDESFLTSPTEKTKKVWKKSEELILEEIK
KGGVLDVDTNTVSGIDNFKPGYIDKENEVIVGLQTDAPLKRIVNPFGGIKMAKDALTDYG
YRIDENMNNIFTKYRKTHNEGVFDSYTEEIRAARHVGLITGLPDAYGRGRIIGDFRRVAL
YGIDYLIEEKKKDLKTLKSPDMLEDILRQREEVSEQIKALYKIKNMAASYGIDISNPAGN
AKEAVQFTYLGYLAGIKENNGAAMSLGRVSTFLDIYIERDLKEGALTEQEAQELIDQFVI
KLRLERHLRTPDYNELFAGDPNWVTECIGGMSIDGRTLVTKNSYRFLNTLTNLGPAPEPN
ITILWSQNLPEPFKKYCSRMSIETDALQYENDDLMRPVYGDDYGIACCVSAMALGKEMQF
FGARCNIAKSLLYAINQGSDEKTFEKIVPHIEKMEDEILNYEKVKKNYFKVLEYVAKLYV
NALNTIHYMHDKYAYEAGLMALHDTKVHRFLACGIAGLSVAADSLSAIKYGKVTPIRNQK
GTAVAFKTEGDFPKYGNDDDRVDDIAVEIVNKFISELRKTETYRNAEHTLSVLTITSNVM
YGKKTGATPDGRKSGEPFAPGANPMHGRDKEGALASLNSVAKIPYRSVCQDGVSNTFSIV
PDALGKDLNTRTNNLASILDGYFSKGAHHLNVNVMHRETLLDAVENPEKYPTLTIRVSGY
AVHFIKLTRQQQEEVIKRTFHQRV
NT seq 2235 nt   +upstreamnt  +downstreamnt
atgaaaaaaaaatggaagaattttaacacaggaaattggacagaaaatattgacgtaaga
aatttcatacaaaaaaattacactccttacactggagatgaaagttttttaacctcccct
acagaaaaaaccaaaaaagtatggaaaaaatctgaagaacttattttagaagaaattaaa
aaaggtggagtgttggatgtagatacaaatactgtatctggaatagataattttaagcct
ggttatatagacaaggagaatgaagttattgtgggactgcagacagatgcaccacttaaa
agaatagtaaatccttttggtggaataaagatggctaaagatgcccttacagattatgga
tacagaattgatgagaatatgaacaatatatttacaaaatacagaaaaacccacaacgaa
ggtgtatttgattcatacacagaggaaataagagctgcaagacatgtaggtcttataaca
ggacttccagatgcctatggaagaggaagaataataggagattttagaagagttgcactc
tatggaatagattatttaattgaagaaaagaagaaagatttaaagacccttaaaagtcct
gatatgctggaagacatactaagacagagagaagaagtatcagagcagataaaagctctt
tataagattaaaaatatggctgcaagttatggaatagacatatcaaatccagccggaaat
gcaaaggaagccgtacaatttacctatcttggctacctggcaggcataaaagaaaataac
ggagctgcaatgtctcttggaagggtttctacatttttggatatatatattgaaagggat
ttaaaagaaggggctttaactgaacaagaagcccaggaacttatagatcaatttgtaata
aaattaagacttgaaagacatttgagaactccagactataatgaactatttgctggagac
cctaactgggtaactgaatgcataggtggtatgtccatagatggaagaacactggttact
aaaaactcctatagatttttaaatacccttacaaacttaggacctgcccctgaaccaaat
ataacaatactatggtcacaaaacttgcctgagccttttaaaaaatactgcagcagaatg
tctattgaaacagatgctctgcagtatgaaaatgatgaccttatgagacctgtatatgga
gatgactatggcatagcctgctgtgtatctgccatggctctgggaaaagaaatgcaattt
ttcggtgccagatgcaatattgcaaaatccctcttatatgccataaaccagggctcagat
gaaaaaacctttgaaaaaatagtaccccatatagaaaaaatggaagatgagattctaaat
tatgaaaaagtaaagaaaaattattttaaggtacttgaatatgtggcaaaattatatgta
aatgccctcaacaccattcactatatgcacgataaatatgcctatgaggcaggacttatg
gcccttcatgataccaaggtccacagatttcttgcctgcggtatagctggtctttcagtg
gcagcggactcattgagtgccataaaatatggaaaagttaccccaattagaaaccagaaa
ggcacagcagtggcttttaaaacagaaggtgattttccaaagtacggtaatgatgatgac
agagtagatgatatagctgtggaaattgtaaataaattcataagtgaactcagaaaaact
gaaacctatagaaatgcagagcataccctctctgtacttaccataacttcaaatgtaatg
tacggtaaaaagacaggagccacaccagatggaagaaaatcaggagaaccttttgcccca
ggtgccaacccaatgcatggaagagataaggaaggcgctctggcatctttaaattcagtg
gctaaaataccttatcgctctgtgtgccaggatggtgtttcaaatacattttccattgta
ccagatgccctgggaaaagatttaaacacaagaacaaataatctggcctccattttggac
ggatatttctcaaagggagcacaccatttaaatgtaaatgtaatgcaccgtgaaaccctg
ttagatgctgtggaaaatcccgaaaaatatccaactttgactatacgtgtttcaggatat
gcagttcattttataaaacttacaagacagcagcaggaagaagtaatcaaaagaactttc
caccaaagagtttaa

DBGET integrated database retrieval system