KEGG   Clostridium kluyveri DSM 555: CKL_1910
Entry
CKL_1910          CDS       T00564                                 
Name
(GenBank) Predicted prophage antirepressor
  KO
K07741  anti-repressor protein
Organism
ckl  Clostridium kluyveri DSM 555
Brite
KEGG Orthology (KO) [BR:ckl00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    CKL_1910
SSDB
Motif
Pfam: ANT Bro-N
Other DBs
NCBI-ProteinID: EDK33922
UniProt: A5MYH6
Position
complement(1988274..1989077)
AA seq 267 aa
MSKLQIFRSKEFGQVRTTFINGKIHFVAVDIARALGYKNTNDAILKHCRWVAKCEVPHPQ
SKTKVIEVNAIPEGDIYRLVANSELPGAQEFESWIFDKVLPQINHTGGYIPNNEDESEED
ILAKAVLIAKRTIERKNEIIADKNKQLQEQKPKVIFAESVQASTTTILIGQLAKILKQNG
IDMGQNRLFEWLRKNGYLISRKGTDYNMPTQKSANLGLFTTKETTIGHSDGHVSISTTPK
VTGKGQVYFVNKFKELQEGVRERQATK
NT seq 804 nt   +upstreamnt  +downstreamnt
ttgagtaagttacaaatttttaggagcaaagaatttgggcaggtaagaactacatttata
aatggaaaaattcattttgtagctgtagatattgccagagcattaggatataaaaataca
aatgatgctattttaaagcactgtaggtgggtagcaaaatgcgaggtacctcatccacag
agtaaaaccaaagttatagaagtcaacgcaataccagagggtgatatttatagattggta
gcaaattctgaattacctggagcacaagaatttgaaagctggatatttgataaagtacta
ccacagataaatcatacaggtggttatataccaaataacgaggatgaatcagaggaagat
atattggctaaagctgttttgatagctaaaagaactattgaaagaaagaacgaaattata
gcagataagaataaacaacttcaggagcaaaagccaaaagtaatatttgcagaaagtgta
caggcatccactacaacaatcttgattgggcaacttgccaaaatattaaagcaaaatgga
attgacatgggacagaatagattatttgaatggcttcgtaaaaatggatacctgattagc
aggaagggtactgattataatatgcctacacaaaagtctgcgaatttaggattatttaca
acaaaggagacaactataggtcattcggatggtcatgtaagtatatctaccacaccaaaa
gtaactgggaaaggacaggtatattttgtgaataagtttaaggaattacaggaaggtgtt
agagaaaggcaggcgacaaaatga

DBGET integrated database retrieval system