KEGG   Clostridium kluyveri DSM 555: CKL_2662
Entry
CKL_2662          CDS       T00564                                 
Name
(GenBank) Phage-related protein
Organism
ckl  Clostridium kluyveri DSM 555
SSDB
Motif
Pfam: DUF2815
Other DBs
NCBI-ProteinID: EDK34674
UniProt: A5N0M8
Position
complement(2734615..2735163)
AA seq 182 aa
MNNQNRTKVVTSVNTRLSYFHGWEPVSINGGAEKYSVSVLIPKSDKETINAINAAVDAAI
EEGIAKFGGKKPNKAAIKLPLRDGDVERDDEAYKGHYFVNANSTTPPQIVDKAVKPILDR
NEVYSGCYARVSLNFYAFNSNGNKGVACGLGNIQKIRDGEPLGSRTTAADDFTTIEDDDF
LA
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaataatcaaaacagaacgaaggttgttacaagcgtcaacacacgtcttagctacttt
cacggctgggagcccgtatccatcaatggtggggcagaaaagtatagtgtatcggtattg
attcctaaatcggataaggaaaccattaatgccatcaatgcagcagttgatgcagctatt
gaagagggcattgcaaagtttggcggtaaaaaaccaaataaggctgctatcaagctgccg
cttcgagatggtgatgtagaacgagatgatgaggcttataaaggacattattttgtaaat
gccaacagcactactccgcctcagattgtagataaagcagtcaagcctattctggatcgc
aatgaggtatacagtggttgctatgcaagagtgtcacttaatttctatgctttcaattct
aatgggaacaagggtgtggcctgcggacttggtaacatccagaagattagagacggagag
cctttaggcagcagaaccacagcggctgatgatttcaccacaattgaagatgatgatttc
ctagcataa

DBGET integrated database retrieval system