KEGG   Clostridium kluyveri DSM 555: CKL_0799Help
Entry
CKL_0799          CDS       T00564                                 

Gene name
fbp
Definition
(GenBank) Fbp
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ckl00010  Glycolysis / Gluconeogenesis
ckl00030  Pentose phosphate pathway
ckl00051  Fructose and mannose metabolism
ckl00680  Methane metabolism
ckl01100  Metabolic pathways
ckl01110  Biosynthesis of secondary metabolites
ckl01120  Microbial metabolism in diverse environments
ckl01130  Biosynthesis of antibiotics
ckl01200  Carbon metabolism
Module
ckl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKL_0799 (fbp)
   00030 Pentose phosphate pathway
    CKL_0799 (fbp)
   00051 Fructose and mannose metabolism
    CKL_0799 (fbp)
  Energy metabolism
   00680 Methane metabolism
    CKL_0799 (fbp)
Enzymes [BR:ckl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CKL_0799 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: EDK32852
UniProt: A5N6C1
Position
792138..794138
Genome map
AA seq 666 aa AA seqDB search
MIFYDENNLDVIEKDLRYLKLLSKEYSTISSASTEIINLQAILNLPKATEHFISDVHGEY
ESFTHMLRNASGVIKRKIDDVFGDSLREEQKAALATLVYYPEKKLEIIKEKEENLEDWYR
ITLYQLIEVCRDVASKYTRSKVRKALPKDFSYIIEELLNKQDDRSDKQAYYSGIIKTIIE
IDRAPEVIIAMSNVIRRLVVDRLHIIGDIYDRGPGAEIIMDALMKHHSVDIQWGNHDVLW
MGAASGCEACMANVLRISLRYANLKTIEDGYGINLLPLATFALEFYQDDPCKRFIPKTLD
KEISENELYLLAKMHKAIAIMQFKLEGQIIKRRPEFKMEDRLLLDKIDVEKWEINVYGNT
YKLNDTNFPTIDWNDPYKLTAREEEIIDKLTNSFINSEKLQRHIRFLYSKGSMYLIYNSN
LLYHGCIPLNEDGSLKEVKIGKINYSGKELLDRYDRVARDSFFFKHNTYNKKYGMDMMWY
MWCGEDSPVFGKIRMTTFERYFISEKASHYEQKNYYYKYRDDEEVCRNILKEFNLSPDSS
HIINGHIPVKTKEGESPIKANGRLLVIDGGFCKAYQPETGIAGYTLIYNSYGLLLTSHEP
FSAIKNAIEEDKDILSSTIILEHAARRKRVMDTDVGTKIRTQVADLEKLLIAYRKGLIKE
DNNELE
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgattttctatgatgagaataatttagatgtaatagaaaaagatttaagatatcttaaa
ttattatctaaagaatactctacaatatctagtgcaagtacggaaattataaatcttcag
gctatattaaatttacctaaagctactgaacatttcataagtgatgttcatggagaatat
gaatcttttacgcatatgttaaggaatgcatctggagtgataaaaagaaaaatagatgat
gtatttggagattcacttagagaagaacaaaaggctgccttggctactttagtatattat
ccagagaagaaattagagattattaaagaaaaagaagaaaacttagaggactggtacagg
ataactttgtatcagttgattgaagtatgtagagatgtagcatctaaatatactagatct
aaagtgagaaaagctcttccaaaggacttttcatatataatagaagaactgctcaataaa
caggatgatagatcagataaacaagcctattatagtggaataataaaaactataatagag
atagatagggcacctgaagttattatagctatgtcaaatgtaatacgaaggttggtagta
gacaggcttcatattatcggagatatatatgatagaggaccaggtgcggaaattataatg
gatgcccttatgaaacatcattctgtagatatacaatggggaaaccatgatgtgctttgg
atgggagcggcttctggatgtgaagcttgtatggctaatgtacttaggatatcgttaaga
tatgctaatttaaaaactattgaggatgggtatggaataaatttgctgccacttgcaaca
tttgctttagaattttatcaggatgatccttgtaaaaggtttattcctaaaaccttagat
aaagaaataagtgaaaatgagctgtatctgctggcaaaaatgcataaggctatagccata
atgcagtttaaattagaaggacaaataataaaaagacgacctgaatttaaaatggaagac
aggcttctgttagataaaatagatgtggaaaaatgggaaataaatgtatatggaaatacc
tataaattaaatgacactaattttcctacaatagactggaatgatccctataagcttaca
gccagagaagaggagattattgataaattaactaattcttttataaacagtgaaaaactc
caaagacatattagatttttgtatagtaaaggaagtatgtatttgatttataattctaat
cttttatatcatggctgtataccgctaaatgaagatggaagtcttaaagaagttaagata
ggaaaaataaactacagtggaaaagaacttcttgatagatatgatcgtgttgctagagat
tcatttttctttaaacataatacttataataagaaatatggaatggatatgatgtggtat
atgtggtgtggagaagattcacctgtatttggaaaaataagaatgacaacttttgaaaga
tattttattagtgaaaaagcctcacattatgaacaaaaaaattattattataaatacaga
gatgatgaagaagtttgcagaaatatattaaaagagttcaatttatctccagatagttct
catattataaatggtcacattcctgtaaagactaaagagggagaaagtcctataaaagca
aatggaaggctgcttgtaatagatggaggattctgtaaggcatatcagcctgaaacaggt
attgcaggatatacccttatatataattcttatggattattacttacttctcatgagcct
ttttctgctataaaaaatgccatagaagaggacaaggatatattatcttctacaataatt
ttagaacatgctgccaggagaaagagggtaatggatacagatgtaggtacaaaaatcaga
acacaggtagcagatcttgaaaaacttttaattgcctatagaaaaggattaatcaaggaa
gacaataatgaattagagtaa

DBGET integrated database retrieval system