KEGG   Clostridium kluyveri DSM 555: CKL_3696Help
Entry
CKL_3696          CDS       T00564                                 

Gene name
thlA1
Definition
(GenBank) ThlA1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ckl00071  Fatty acid degradation
ckl00280  Valine, leucine and isoleucine degradation
ckl00310  Lysine degradation
ckl00362  Benzoate degradation
ckl00380  Tryptophan metabolism
ckl00620  Pyruvate metabolism
ckl00630  Glyoxylate and dicarboxylate metabolism
ckl00640  Propanoate metabolism
ckl00650  Butanoate metabolism
ckl00900  Terpenoid backbone biosynthesis
ckl01100  Metabolic pathways
ckl01110  Biosynthesis of secondary metabolites
ckl01120  Microbial metabolism in diverse environments
ckl01130  Biosynthesis of antibiotics
ckl01200  Carbon metabolism
ckl01212  Fatty acid metabolism
ckl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ckl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKL_3696 (thlA1)
   00630 Glyoxylate and dicarboxylate metabolism
    CKL_3696 (thlA1)
   00640 Propanoate metabolism
    CKL_3696 (thlA1)
   00650 Butanoate metabolism
    CKL_3696 (thlA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CKL_3696 (thlA1)
   00072 Synthesis and degradation of ketone bodies
    CKL_3696 (thlA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKL_3696 (thlA1)
   00310 Lysine degradation
    CKL_3696 (thlA1)
   00380 Tryptophan metabolism
    CKL_3696 (thlA1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CKL_3696 (thlA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKL_3696 (thlA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CKL_3696 (thlA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ckl04147]
    CKL_3696 (thlA1)
Enzymes [BR:ckl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CKL_3696 (thlA1)
Exosome [BR:ckl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKL_3696 (thlA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: EDK35681
UniProt: A5N3I5
Position
complement(3734524..3735705)
Genome map
AA seq 393 aa AA seqDB search
MREVVIVSAVRTAIGSFGGTLKDVSAVDLGAIVIKEAVKRAGIKPEQVDEVIFGNVIQAG
VGQSLARQSAVYAGLPVEVPAFTVNKLCGSGLRTVSLAASLISNGDADTIVVGGSENMSA
SPYLIPKARFGYRMGEAKIYDAMLHDGLIDSFNNYHMGITAENIAEKWGITREDQDKFAL
ASQQKAEAAIKAGKFKDEIVPVTVKMKKKEVVFDTDEDPRFGTTIETLAKLKPAFKRDGT
GTVTAGNSSGINDSSAALILMSADKAKELGVKPMAKYVDFASAGLDPAIMGYGPYYATKK
VLAKTNLTIKDFDLIEANEAFAAQSIAVARDLEFDMSKVNVNGGAIALGHPVGCSGARIL
VTLLHEMQKRDAKKGLATLCIGGGQGTAVVVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtagttattgtaagtgctgtaagaacagcgataggaagttttgggggaact
ttaaaagatgtttctgctgtagatttaggagctatagttataaaagaagcagtaaaaaga
gcaggtatcaaaccagaacaagtagatgaagttatatttggaaatgtaatacaagcaggt
gttggacaaagtttagcaagacaatcagctgtatatgcaggtcttccagtagaagtacca
gctttcacagtgaataagctttgtggttcaggacttagaacagtaagtttagcagctagt
cttatcagcaacggagatgctgatacaattgtagttggtggatcagaaaacatgtctgca
tctccatatttaattccaaaagctagatttggatatagaatgggagaagcaaaaatatat
gatgctatgttacatgatggacttatagattcattcaacaactatcacatgggaatcaca
gctgaaaatatagcagaaaaatggggaataacaagagaagatcaagataaatttgcatta
gcatcccaacagaaggcagaagcagctataaaagcaggaaagttcaaagatgaaatagtt
ccagtaactgtaaaaatgaaaaagaaagaggtagtttttgatactgatgaagatccaaga
tttggtacaactatagaaacattagcaaaattgaaacctgcatttaagagagatggaaca
ggaacagttacagcaggtaattcttcaggaataaatgattcatcagcagcattaatctta
atgagtgcagataaagcaaaggaacttggagttaaaccaatggcaaaatatgttgatttt
gcaagcgcaggattagatccagctatcatgggatatggaccatattatgcaacaaaaaaa
gtgcttgcgaaaactaatttaacaataaaggactttgatttaatagaagcaaatgaagca
tttgcagctcaaagtatagcagtagcaagagatttagaatttgatatgagcaaagtaaat
gtaaatggaggagcaatagctcttggacatccagttggctgctctggtgcaagaatactt
gttacactacttcacgaaatgcaaaagagagatgcaaagaaaggtcttgcaacactttgc
ataggtggaggacaaggaaccgctgtagtagttgaaagataa

DBGET integrated database retrieval system